Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.89
PubTator Score 1.88

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWV      1 - 70
VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVC     71 - 140
LPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCM    141 - 210
GDSGGPLVCQKDGAWTLVGIVSWGSRTCSTTTPAVYARVAKLIPWVQKILAAN                     211 - 263
//

Text Mined References (9)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8186414 1993 Genomic cloning and partial characterization of human chymotrypsinogen gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2917002 1989 Molecular cloning and nucleotide sequence of human pancreatic prechymotrypsinogen cDNA.