Property Summary

NCBI Gene PubMed Count 65
PubMed Score 73.17
PubTator Score 72.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (31)

Disease log2 FC p
active Crohn's disease 2.015 1.9e-03
active ulcerative colitis 1.693 1.6e-02
Atopic dermatitis 1.500 1.4e-03
cutaneous lupus erythematosus 2.800 1.1e-05
cystic fibrosis 1.700 3.1e-03
dermatomyositis 1.200 1.5e-02
group 4 medulloblastoma -1.400 9.8e-04
hepatocellular carcinoma 1.200 1.9e-02
inflammatory breast cancer 1.300 4.0e-02
interstitial cystitis 1.100 3.0e-02
intraductal papillary-mucinous neoplasm ... 2.000 1.7e-03
invasive ductal carcinoma 1.020 3.3e-02
juvenile dermatomyositis 3.095 4.2e-17
lung cancer -1.600 1.4e-02
lung carcinoma -2.300 3.9e-22
malignant mesothelioma 4.300 2.1e-09
medulloblastoma, large-cell -1.800 1.8e-04
Multiple Sclerosis 1.400 1.7e-02
nasopharyngeal carcinoma 1.300 2.7e-02
non-small cell lung cancer -1.087 6.8e-07
osteosarcoma 3.026 5.1e-04
ovarian cancer 1.500 1.1e-03
pancreatic cancer 1.500 1.3e-04
pancreatic ductal adenocarcinoma liver m... 1.911 5.6e-03
pituitary cancer -1.100 1.8e-03
primary Sjogren syndrome 2.500 2.6e-04
psoriasis 2.000 1.8e-07
sarcoidosis 1.100 2.3e-02
subependymal giant cell astrocytoma 2.937 3.6e-02
Systemic lupus erythematosus 1.400 1.7e-03
tuberculosis 1.900 2.6e-04

Gene RIF (62)

AA Sequence

MEGDFSVCRNCKRHVVSANFTLHEAYCLRFLVLCPECEEPVPKETMEEHCKLEHQQVGCTMCQQSMQKSS      1 - 70
LEFHKANECQERPVECKFCKLDMQLSKLELHESYCGSRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGK     71 - 140
GERISAPEREIYCHYCNQMIPENKYFHHMGKCCPDSEFKKHFPVGNPEILPSSLPSQAAENQTSTMEKDV    141 - 210
RPKTRSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDILRRCSQCGILLPLPILN    211 - 280
QHQEKCRWLASSKGKQVRNFS                                                     281 - 301
//

Text Mined References (70)

PMID Year Title