Property Summary

NCBI Gene PubMed Count 55
Grant Count 20
R01 Count 16
Funding $874,440.26
PubMed Score 69.48
PubTator Score 72.79

Knowledge Summary

Patent

No data available

Expression

Gene RIF (52)

PMID Text
26116899 HIV-1 Vpr upregulates the gene expression of XAF1 in human monocyte-derived dendritic cells
25824780 Underexpression of XAF1 confers cisplatin-resistance in ovarian carcinoma.
25539606 Restored XAF1 expression inhibits cell proliferation and induces cell apoptosis in human lung adenocarcinoma cell line A549. Furthermore, XAF1 may activate associated apoptotic signaling pathways in A549 cell line.
25367849 Up-regulation of XAF1 distinctly increased apoptosis in colorectal cancer cells administered cisplatin.
25313037 XAF1 stimulates HIPK2-mediated Ser-46 phosphorylation of p53 and XAF1 also steps up the termination of p53-mediated cell-cycle arrest by activating ZNF313.
25216542 Our study identified a novel splice variant of XAF1 in cancer cells
24663488 XAF1 as a possible sarcoidosis risk gene
24249729 Transcriptionally active p73 induces translocation of XAF-1 during apoptosis caused by melphalan. XAF-1 directly interacts with Puma and promotes Bax translocation during melphalan-induced apoptosis.
23645777 Missense polymorphisms in XIAP-associated factor-1 is associated with papillary thyroid cancer.
23333304 HIV-1 Vpr upregulates the gene expression of XAF1 in human monocyte-derived dendritic cells
More...

AA Sequence

MEGDFSVCRNCKRHVVSANFTLHEAYCLRFLVLCPECEEPVPKETMEEHCKLEHQQVGCTMCQQSMQKSS      1 - 70
LEFHKANECQERPVECKFCKLDMQLSKLELHESYCGSRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGK     71 - 140
GERISAPEREIYCHYCNQMIPENKYFHHMGKCCPDSEFKKHFPVGNPEILPSSLPSQAAENQTSTMEKDV    141 - 210
RPKTRSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDILRRCSQCGILLPLPILN    211 - 280
QHQEKCRWLASSKGKQVRNFS                                                     281 - 301
//

Text Mined References (60)

PMID Year Title
25824780 2015 XIAP associated factor 1 (XAF1) represses expression of X-linked inhibitor of apoptosis protein (XIAP) and regulates invasion, cell cycle, apoptosis, and cisplatin sensitivity of ovarian carcinoma cells.
25539606 2014 [XAF1 inhibits cell proliferation and induces apoptosis in human lung adenocarcinoma cell line A549 in vitro].
25367849 2014 X-linked inhibitor of apoptosis-associated factor l (XAFl) enhances the sensitivity of colorectal cancer cells to cisplatin.
25313037 2014 XAF1 directs apoptotic switch of p53 signaling through activation of HIPK2 and ZNF313.
25216542 2015 A novel splice variant of XIAP-associated factor 1 (XAF1) is expressed in peripheral blood containing gastric cancer-derived circulating tumor cells.
24663488 2014 Admixture fine-mapping in African Americans implicates XAF1 as a possible sarcoidosis risk gene.
24249729 2013 Melphalan-induced apoptosis of EBV-transformed B cells through upregulation of TAp73 and XAF1 and nuclear import of XPA.
23645777 2013 Missense polymorphisms in XIAP-associated factor-1 (XAF1) and risk of papillary thyroid cancer: correlation with clinicopathological features.
23645206 2013 ZNF313 is a novel cell cycle activator with an E3 ligase activity inhibiting cellular senescence by destabilizing p21(WAF1.).
23207547 2013 XAF1 contributes to dengue virus-induced apoptosis in vascular endothelial cells.
More...