Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.06
PubTator Score 0.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 3.1e-02

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.040 3.1e-02

Gene RIF (1)

AA Sequence

MHRGVGPAFRVVRKMAASGAEPQVLVQYLVLRKDLSQAPFSWPAGALVAQACHAATAALHTHRDHPHTAA      1 - 70
YLQELGRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK     71 - 140
//

Text Mined References (10)

PMID Year Title