Property Summary

NCBI Gene PubMed Count 7
Grant Count 5
R01 Count 5
Funding $302,613
PubMed Score 4.73
PubTator Score 7.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.200 0.000
lung carcinoma 1.300 0.000
invasive ductal carcinoma 1.100 0.034

Gene RIF (5)

PMID Text
25885783 A male patient with neuropsychiatric disorders attributed to a FAAH2 missense mutation is described.
23898208 HIV-1 Tat upregulates the expression of fatty acid amide hydrolase 2 (FAAH2) in human primary T cells
19926788 results establish FAAH-2 as a bone fide N-acylethanolamine-catabolizing enzyme and suggest that inactivation is spatially separated in cells of higher mammals
19095868 Biochemical and biological properties of 4-(3-phenyl-[1,2,4] thiadiazol-5-yl)-piperazine-1-carboxylic acid phenylamide, a mechanism-based inhibitor of fatty acid amide hydrolase.
17015445 FAAH2 is the second membrane-associated AS enzyme in humans that displays FAAH activity

AA Sequence

MAPSFTARIQLFLLRALGFLIGLVGRAALVLGGPKFASKTPRPVTEPLLLLSGMQLAKLIRQRKVKCIDV      1 - 70
VQAYINRIKDVNPMINGIVKYRFEEAMKEAHAVDQKLAEKQEDEATLENKWPFLGVPLTVKEAFQLQGMP     71 - 140
NSSGLMNRRDAIAKTDATVVALLKGAGAIPLGITNCSELCMWYESSNKIYGRSNNPYDLQHIVGGSSGGE    141 - 210
GCTLAAACSVIGVGSDIGGSIRMPAFFNGIFGHKPSPGVVPNKGQFPLAVGAQELFLCTGPMCRYAEDLA    211 - 280
PMLKVMAGPGIKRLKLDTKVHLKDLKFYWMEHDGGSFLMSKVDQDLIMTQKKVVVHLETILGASVQHVKL    281 - 350
KKMKYSFQLWIAMMSAKGHDGKEPVKFVDLLGDHGKHVSPLWELIKWCLGLSVYTIPSIGLALLEEKLRY    351 - 420
SNEKYQKFKAVEESLRKELVDMLGDDGVFLYPSHPTVAPKHHVPLTRPFNFAYTGVFSALGLPVTQCPLG    421 - 490
LNAKGLPLGIQVVAGPFNDHLTLAVAQYLEKTFGGWVCPGKF                                491 - 532
//

Text Mined References (9)

PMID Year Title
25885783 2015 Defects in fatty acid amide hydrolase 2 in a male with neurologic and psychiatric symptoms.
19926788 2010 Lipid droplets are novel sites of N-acylethanolamine inactivation by fatty acid amide hydrolase-2.
19095868 2009 Biochemical and biological properties of 4-(3-phenyl-[1,2,4] thiadiazol-5-yl)-piperazine-1-carboxylic acid phenylamide, a mechanism-based inhibitor of fatty acid amide hydrolase.
17015445 2006 A second fatty acid amide hydrolase with variable distribution among placental mammals.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.