Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.73
PubTator Score 7.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Renal Cell Carcinoma 199
Disease Target Count P-value
lung carcinoma 2844 9.24393668336617E-20
breast carcinoma 1614 4.51184001323107E-4
invasive ductal carcinoma 2950 0.0340355932085832
Disease Target Count Z-score Confidence
Renal oncocytoma 22 3.868 1.9
Learning disability 20 3.136 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.200 0.000
lung carcinoma 1.300 0.000
invasive ductal carcinoma 1.100 0.034

Synonym

Accession Q6GMR7 Q86VT2 Q96N98
Symbols AMDD

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (5)

PMID Text
25885783 A male patient with neuropsychiatric disorders attributed to a FAAH2 missense mutation is described.
23898208 HIV-1 Tat upregulates the expression of fatty acid amide hydrolase 2 (FAAH2) in human primary T cells
19926788 results establish FAAH-2 as a bone fide N-acylethanolamine-catabolizing enzyme and suggest that inactivation is spatially separated in cells of higher mammals
19095868 Biochemical and biological properties of 4-(3-phenyl-[1,2,4] thiadiazol-5-yl)-piperazine-1-carboxylic acid phenylamide, a mechanism-based inhibitor of fatty acid amide hydrolase.
17015445 FAAH2 is the second membrane-associated AS enzyme in humans that displays FAAH activity

AA Sequence

MAPSFTARIQLFLLRALGFLIGLVGRAALVLGGPKFASKTPRPVTEPLLLLSGMQLAKLIRQRKVKCIDV      1 - 70
VQAYINRIKDVNPMINGIVKYRFEEAMKEAHAVDQKLAEKQEDEATLENKWPFLGVPLTVKEAFQLQGMP     71 - 140
NSSGLMNRRDAIAKTDATVVALLKGAGAIPLGITNCSELCMWYESSNKIYGRSNNPYDLQHIVGGSSGGE    141 - 210
GCTLAAACSVIGVGSDIGGSIRMPAFFNGIFGHKPSPGVVPNKGQFPLAVGAQELFLCTGPMCRYAEDLA    211 - 280
PMLKVMAGPGIKRLKLDTKVHLKDLKFYWMEHDGGSFLMSKVDQDLIMTQKKVVVHLETILGASVQHVKL    281 - 350
KKMKYSFQLWIAMMSAKGHDGKEPVKFVDLLGDHGKHVSPLWELIKWCLGLSVYTIPSIGLALLEEKLRY    351 - 420
SNEKYQKFKAVEESLRKELVDMLGDDGVFLYPSHPTVAPKHHVPLTRPFNFAYTGVFSALGLPVTQCPLG    421 - 490
LNAKGLPLGIQVVAGPFNDHLTLAVAQYLEKTFGGWVCPGKF                                491 - 532
//

Text Mined References (9)

PMID Year Title
25885783 2015 Defects in fatty acid amide hydrolase 2 in a male with neurologic and psychiatric symptoms.
19926788 2010 Lipid droplets are novel sites of N-acylethanolamine inactivation by fatty acid amide hydrolase-2.
19095868 2009 Biochemical and biological properties of 4-(3-phenyl-[1,2,4] thiadiazol-5-yl)-piperazine-1-carboxylic acid phenylamide, a mechanism-based inhibitor of fatty acid amide hydrolase.
17015445 2006 A second fatty acid amide hydrolase with variable distribution among placental mammals.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.