Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.34
PubTator Score 6.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Dermatologic disorders 93
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 0.7

Expression

Gene RIF (4)

AA Sequence

MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGS      1 - 70
VPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQASVSDTAQQPSEEQSKSLE     71 - 140
KPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI      141 - 208
//

Text Mined References (20)

PMID Year Title