Property Summary

NCBI Gene PubMed Count 41
PubMed Score 64.27
PubTator Score 39.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 7.9e-07
psoriasis 6694 2.2e-04
colon cancer 1478 1.8e-03
lung cancer 4740 2.9e-02
Breast cancer 3578 4.7e-02

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.700 4.7e-02
colon cancer 1.300 1.8e-03
lung cancer 1.600 2.9e-02
ovarian cancer 2.100 7.9e-07
psoriasis 1.400 2.2e-04

Gene RIF (26)

AA Sequence

MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPG      1 - 70
STTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEV     71 - 140
QSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSM    141 - 210
DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLG    211 - 280
DAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA                                          281 - 312
//

Text Mined References (51)

PMID Year Title