Property Summary

NCBI Gene PubMed Count 38
Grant Count 17
R01 Count 7
Funding $1,210,672.72
PubMed Score 59.63
PubTator Score 39.21

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.400 0.000
lung cancer 1.600 0.029
colon cancer 1.300 0.002
Breast cancer 1.700 0.047
ovarian cancer 2.100 0.000

Gene RIF (25)

PMID Text
25901506 results of the present study suggest that downregulation of the CIAPIN1 gene in multiple myeloma cells may be associated with the development of this disease.
25889687 CIAPIN1 and ABCA13 may be novel markers of poor outcome in pre-chemotherapy serous carcinoma effusions.
25724898 CIAPIN1 over-expression decreases NHE1 expression and ERK1/2 phosphorylation.
25043809 CIAPIN1 targeted NHE1 to mediate differentiation of K562 cells via ERK1/2 pathway.
24973211 the 25-kDa cleaved fragment of anamorsin was detected in post-mortem brains of Alzheimer and Parkinson disease patients
24676475 lentivirus-vector-mediated RNAi targeting of CIAPIN1 is a potential approach to reverse MDR of breast cancer and CIAPIN1 may participate in MDR of breast cancer by regulating P-glycoprotein and P53 expression.
24123282 The N-terminal methyltransferase-like domain of anamorsin probably functions as a structural scaffold to inhibit methyl transfers.
23989406 Mossbauer and EPR spectra of human anamorsin show that both the M1 motif and the M2 motif bind independently a [2Fe-2S] cluster through the four cysteines of each motif.
23596212 the molecular basis of recognition between Ndor1 and anamorsin and of the electron transfer process, was investigated.
23151078 CIAPIN1 siRNA inhibited proliferation, migration and promotes apoptosis of vascular smooth muscle cells by regulating Bcl-2 and Bax.
More...

AA Sequence

MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPG      1 - 70
STTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEV     71 - 140
QSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSM    141 - 210
DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLG    211 - 280
DAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA                                          281 - 312
//

Text Mined References (47)

PMID Year Title
25901506 2015 Cytokine-induced apoptosis inhibitor 1 inhibits the growth and proliferation of multiple myeloma.
25889687 2015 CIAPIN1 and ABCA13 are markers of poor survival in metastatic ovarian serous carcinoma.
25724898 2015 CIAPIN1 targets Na?/H? exchanger 1 to mediate MDA-MB-231 cells' metastasis through regulation of MMPs via ERK1/2 signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25043809 2014 CIAPIN1 targets Na+/H+ exchanger 1 to mediate K562 chronic myeloid leukemia cells' differentiation via ERK1/2 signaling pathway.
24973211 2014 Anamorsin, a novel caspase-3 substrate in neurodegeneration.
24676475 2014 CIAPIN1 gene silencing enhances chemosensitivity in a drug-resistant animal model in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24123282 2014 Crystal structure of the N-terminal methyltransferase-like domain of anamorsin.
23989406 2013 Human anamorsin binds [2Fe-2S] clusters with unique electronic properties.
More...