Property Summary

NCBI Gene PubMed Count 33
PubMed Score 999.32
PubTator Score 101.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 1.300 2.8e-07

 GO Process (1)

Gene RIF (6)

AA Sequence

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (47)

PMID Year Title