Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1012.36
PubTator Score 101.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 1.300 2.8e-07

 GO Function (1)

 GO Process (1)

Gene RIF (6)

PMID Text
22980979 Ubiquitin-dependent signaling during the DNA damage response (DDR) to double-strand breaks is initiated by two E3 ligases, RNF8 and RNF168, targeting histone H2A and H2AX. Study shows that ubiquitin chains per se are insufficient for signaling, but RNF168 target ubiquitination is required for DDR damage.
20599239 HIV-1 Tat activated transcription facilitates removal of histones H2A and H2B at the LTR, and the FACT complex, at least consisting of SPT16 and SSRP1, may be responsible for their removal
14657027 HIV-1 Tat activated transcription facilitates removal of histones H2A and H2B at the LTR, and the FACT complex, at least consisting of SPT16 and SSRP1, may be responsible for their removal
11689053 HIV-1 Tat activated transcription facilitates removal of histones H2A and H2B at the LTR, and the FACT complex, at least consisting of SPT16 and SSRP1, may be responsible for their removal
11080476 HIV-1 Tat activated transcription facilitates removal of histones H2A and H2B at the LTR, and the FACT complex, at least consisting of SPT16 and SSRP1, may be responsible for their removal
9566873 HIV-1 Tat activated transcription facilitates removal of histones H2A and H2B at the LTR, and the FACT complex, at least consisting of SPT16 and SSRP1, may be responsible for their removal

AA Sequence

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (43)

PMID Year Title
27402160 2016 A subset of replication-dependent histone mRNAs are expressed as polyadenylated RNAs in terminally differentiated tissues.
25470042 2014 TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.
24352239 2014 Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification.
24140421 2013 VprBP has intrinsic kinase activity targeting histone H2A and represses gene transcription.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22980979 2012 RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.
22713238 2012 A novel ubiquitin mark at the N-terminal tail of histone H2As targeted by RNF168 ubiquitin ligase.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19203579 2009 RNF168 binds and amplifies ubiquitin conjugates on damaged chromosomes to allow accumulation of repair proteins.
19203578 2009 The RIDDLE syndrome protein mediates a ubiquitin-dependent signaling cascade at sites of DNA damage.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18001825 2007 RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly.
18001824 2007 RNF8 ubiquitylates histones at DNA double-strand breaks and promotes assembly of repair proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16702407 2006 DNA damage triggers nucleotide excision repair-dependent monoubiquitylation of histone H2A.
16457589 2006 Precise characterization of human histones in the H2A gene family by top down mass spectrometry.
16359901 2005 Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing.
16319397 2006 Characterization of histone H2A and H2B variants and their post-translational modifications by mass spectrometry.
15823041 2005 Deimination of histone H2A and H4 at arginine 3 in HL-60 granulocytes.
15635413 2005 Nucleolar proteome dynamics.
15527963 2004 Functional characterization of a human histone gene cluster duplication.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15386022 2004 Role of histone H2A ubiquitination in Polycomb silencing.
15078818 2004 Nucleosomal histone kinase-1 phosphorylates H2A Thr 119 during mitosis in the early Drosophila embryo.
15010469 2004 Phosphorylation of histone H2A inhibits transcription on chromatin templates.
14759373 2004 CTCF tethers an insulator to subnuclear sites, suggesting shared insulator mechanisms across species.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657027 2003 Regulation of HIV-1 gene expression by histone acetylation and factor recruitment at the LTR promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
11689053 2001 Enhancement of the p300 HAT activity by HIV-1 Tat on chromatin DNA.
11375490 2001 Chromatin docking and exchange activity enhancement of RCC1 by histones H2A and H2B.
11181995 2001 The sequence of the human genome.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.
9439656 1997 The human histone gene cluster at the D6S105 locus.
8858345 1996 Characterization of the 55-kb mouse histone gene cluster on chromosome 3.
8543049 1995 Characterization of functionally independent domains in the human ubiquitin conjugating enzyme UbcH2.
8179821 1994 The relative expression of human histone H2A genes is similar in different types of proliferating cells.
6326092 1984 Evidence for a human histone gene cluster containing H2B and H2A pseudogenes.
2071153 1991 Single-copy flanking sequences in human histone gene clusters map to chromosomes 1 and 6.