Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1012.36
PubTator Score 101.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 1.300 0.000

Synonym

Accession Q6FI13 B2R5F0 P20670
Symbols H2A
H2A.2
H2A/O
H2A/q
H2AFO
H2a-615
HIST2H2AA

Gene

 GO Function (1)

 GO Process (1)

Gene RIF (6)

PMID Text
22980979 Ubiquitin-dependent signaling during the DNA damage response (DDR) to double-strand breaks is initiated by two E3 ligases, RNF8 and RNF168, targeting histone H2A and H2AX. Study shows that ubiquitin chains per se are insufficient for signaling, but RNF168 target ubiquitination is required for DDR damage.
20599239 HIV-1 Tat activated transcription facilitates removal of histones H2A and H2B at the LTR, and the FACT complex, at least consisting of SPT16 and SSRP1, may be responsible for their removal
14657027 HIV-1 Tat activated transcription facilitates removal of histones H2A and H2B at the LTR, and the FACT complex, at least consisting of SPT16 and SSRP1, may be responsible for their removal
11689053 HIV-1 Tat activated transcription facilitates removal of histones H2A and H2B at the LTR, and the FACT complex, at least consisting of SPT16 and SSRP1, may be responsible for their removal
11080476 HIV-1 Tat activated transcription facilitates removal of histones H2A and H2B at the LTR, and the FACT complex, at least consisting of SPT16 and SSRP1, may be responsible for their removal
9566873 HIV-1 Tat activated transcription facilitates removal of histones H2A and H2B at the LTR, and the FACT complex, at least consisting of SPT16 and SSRP1, may be responsible for their removal

AA Sequence

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (43)

PMID Year Title
27402160 2016 A subset of replication-dependent histone mRNAs are expressed as polyadenylated RNAs in terminally differentiated tissues.
25470042 2014 TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.
24352239 2014 Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification.
24140421 2013 VprBP has intrinsic kinase activity targeting histone H2A and represses gene transcription.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22980979 2012 RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.
22713238 2012 A novel ubiquitin mark at the N-terminal tail of histone H2As targeted by RNF168 ubiquitin ligase.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...