Property Summary

NCBI Gene PubMed Count 66
Grant Count 21
R01 Count 13
Funding $1,111,741
PubMed Score 91.25
PubTator Score 82.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (53)

PMID Text
26868304 proliferation of IGFBP5-mutated cancer cells is selectively blocked by IGF-1R inhibitors
26397159 Down-regulation of SFRP4 is associated with recurrence in Endometrioid Adenocarcinoma.
26041556 concentrations of serum SFRP4 in T2DM and impaired glucose tolerance subjects were increased and were correlated closely with glycose metabolic disorder, the first-phase of glucose-stimulated insulin secretion and chronic low-grade inflammation
25872484 We found that miR-203 was significantly downregulated in OSF tissues compared to that in normal buccal mucosa tissues, and that miR-203 negatively regulated secreted SFRP4 and positively regulated TM4SF1
25825452 findings suggest that an epigenetic event is critically involved in the pathogenesis of psoriasis, and the downregulation of SFRP4 by CpG island methylation is one possible mechanism contributing to the hyperplasia of epidermis in the disease
25805505 Wnt3a can modulate intracellular localisation and secretion of sFRP4.
25501511 Increased SFRP4 expression may not always correlate with an increase in apoptosis, possibly due to the complex interactions between different signalling pathways. [Review]
25408147 SFRP4 concentrations are associated with impaired glucose and triglyceride metabolism
25322919 Abdominal adipose tissue is a major contributor for circulating-SFRP4; SFRP4 has an important role in obese adipose tissue pathophysiology.
25107489 Aberrant methylation of APC gene was statistically significant associated with age over 50, DDK3 with male, SFRP4, WIF1, and WNT5a with increasing tumor stage SFRP4 and WIF1 with tumor differentiation and SFRP2 and SFRP5 with histological type
More...

AA Sequence

MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCS      1 - 70
AVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPE     71 - 140
AIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSG    141 - 210
CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQL    211 - 280
SKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV        281 - 346
//

Text Mined References (68)

PMID Year Title
27355534 2016 Cortical-Bone Fragility--Insights from sFRP4 Deficiency in Pyle's Disease.
26868304 2016 Therapeutic approach to target mesothelioma cancer cells using the Wnt antagonist, secreted frizzled-related protein 4: Metabolic state of cancer cells.
26397159 2016 Expression Patterns of the Wnt Pathway Inhibitors Dickkopf3 and Secreted Frizzled-Related Proteins 1 and 4 in Endometrial Endometrioid Adenocarcinoma: An NRG Oncology/Gynecologic Oncology Group Study.
26041556 2015 Relationship between serum secreted frizzled-related protein 4 levels and the first-phase of glucose-stimulated insulin secretion in individuals with different glucose tolerance.
25872484 2015 miR-203 inhibits arecoline-induced epithelial-mesenchymal transition by regulating secreted frizzled-related protein 4 and transmembrane-4 L six family member 1 in oral submucous fibrosis.
25825452 2015 Epigenetic downregulation of SFRP4 contributes to epidermal hyperplasia in psoriasis.
25805505 2015 Number and brightness analysis of sFRP4 domains in live cells demonstrates vesicle association signal of the NLD domain and dynamic intracellular responses to Wnt3a.
25501511 2015 Secreted frizzled-related protein 4 and its implications in cancer and apoptosis.
25408147 2014 Association of secreted frizzled-related protein 4 (SFRP4) with type 2 diabetes in patients with stable coronary artery disease.
25322919 2015 Elevated secreted frizzled-related protein 4 in obesity: a potential role in adipose tissue dysfunction.
More...