Property Summary

NCBI Gene PubMed Count 73
PubMed Score 108.00
PubTator Score 82.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Globe disease 67 0.0 3.0
Osteoporosis 363 0.0 3.0
Disease Target Count Z-score Confidence
Metaphyseal dysplasia 11 3.438 1.7
Disease Target Count Z-score Confidence
Osteomalacia 35 4.112 2.1
Hypophosphatemia 40 4.022 2.0
Cancer 2499 3.581 1.8
Rickets 49 3.526 1.8
Disease Target Count
Pyle metaphyseal dysplasia 8

Expression

Protein-protein Interaction (8)

Gene RIF (59)

AA Sequence

MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCS      1 - 70
AVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPE     71 - 140
AIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSG    141 - 210
CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQL    211 - 280
SKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV        281 - 346
//

Text Mined References (75)

PMID Year Title