Property Summary

NCBI Gene PubMed Count 66
PubMed Score 91.25
PubTator Score 82.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
periodontitis 269 2.52178719556121E-21
posterior fossa group A ependymoma 1511 1.43273544143423E-11
Duchenne muscular dystrophy 602 1.96717221658554E-7
pancreatic cancer 2300 3.86015954643686E-7
pilocytic astrocytoma 3086 8.70198416608034E-7
primary pancreatic ductal adenocarcinoma 1271 1.65617058573909E-6
adult high grade glioma 2148 1.30558398176288E-5
glioblastoma 5572 1.41887746862713E-5
Breast cancer 3099 3.62585112707642E-5
limb girdle muscular dystrophy 2A 156 1.34837865424259E-4
sonic hedgehog group medulloblastoma 1482 2.14728445102734E-4
medulloblastoma, large-cell 6234 2.91699111228903E-4
adrenocortical adenoma 134 4.44244038747858E-4
interstitial cystitis 2299 6.22624553606995E-4
fascioscapulohumeral muscular dystrophy 100 0.00107256101596642
subependymal giant cell astrocytoma 2287 0.00110750668015722
pituitary cancer 1972 0.00187752843277554
atypical teratoid / rhabdoid tumor 4369 0.0028384437806781
ovarian cancer 8492 0.00657753064580533
primitive neuroectodermal tumor 3031 0.00696078599214722
diabetes mellitus 1663 0.0124323433256971
non diabetic and post-ischemic heart failure 200 0.0146161036861381
type II diabetes mellitus and post-ischemic heart failure 89 0.0149540744282377
non-small cell lung cancer and chronic obstructive pulmonary disease 7 0.015425655803523
head and neck cancer 270 0.0253521227621706
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0293993082980651
Chronic obstructive pulmonary disease 147 0.03014595640916
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0306842996291125
Endometriosis 535 0.033003026436014
gastric carcinoma 832 0.036377841548001
invasive ductal carcinoma 2950 0.0373132690261654
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0441967892997689
Disease Target Count Z-score Confidence
Globe disease 57 0.0 2.0
Osteoporosis 259 0.0 2.0
Disease Target Count
Pyle metaphyseal dysplasia 1

Expression

Synonym

Accession Q6FHJ7 B4DYC1 O14877 Q05BG7 Q1ZYW2 Q4G124 Q6FHM0 Q6PD64 sFRP-4
Symbols PYL
FRP-4
FRPHE
sFRP-4

Gene

  Ortholog (7)

Gene RIF (53)

PMID Text
26868304 proliferation of IGFBP5-mutated cancer cells is selectively blocked by IGF-1R inhibitors
26397159 Down-regulation of SFRP4 is associated with recurrence in Endometrioid Adenocarcinoma.
26041556 concentrations of serum SFRP4 in T2DM and impaired glucose tolerance subjects were increased and were correlated closely with glycose metabolic disorder, the first-phase of glucose-stimulated insulin secretion and chronic low-grade inflammation
25872484 We found that miR-203 was significantly downregulated in OSF tissues compared to that in normal buccal mucosa tissues, and that miR-203 negatively regulated secreted SFRP4 and positively regulated TM4SF1
25825452 findings suggest that an epigenetic event is critically involved in the pathogenesis of psoriasis, and the downregulation of SFRP4 by CpG island methylation is one possible mechanism contributing to the hyperplasia of epidermis in the disease
25805505 Wnt3a can modulate intracellular localisation and secretion of sFRP4.
25501511 Increased SFRP4 expression may not always correlate with an increase in apoptosis, possibly due to the complex interactions between different signalling pathways. [Review]
25408147 SFRP4 concentrations are associated with impaired glucose and triglyceride metabolism
25322919 Abdominal adipose tissue is a major contributor for circulating-SFRP4; SFRP4 has an important role in obese adipose tissue pathophysiology.
25107489 Aberrant methylation of APC gene was statistically significant associated with age over 50, DDK3 with male, SFRP4, WIF1, and WNT5a with increasing tumor stage SFRP4 and WIF1 with tumor differentiation and SFRP2 and SFRP5 with histological type
More...

AA Sequence

MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCS      1 - 70
AVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPE     71 - 140
AIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSG    141 - 210
CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQL    211 - 280
SKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV        281 - 346
//

Text Mined References (68)

PMID Year Title
27355534 2016 Cortical-Bone Fragility--Insights from sFRP4 Deficiency in Pyle's Disease.
26868304 2016 Therapeutic approach to target mesothelioma cancer cells using the Wnt antagonist, secreted frizzled-related protein 4: Metabolic state of cancer cells.
26397159 2016 Expression Patterns of the Wnt Pathway Inhibitors Dickkopf3 and Secreted Frizzled-Related Proteins 1 and 4 in Endometrial Endometrioid Adenocarcinoma: An NRG Oncology/Gynecologic Oncology Group Study.
26041556 2015 Relationship between serum secreted frizzled-related protein 4 levels and the first-phase of glucose-stimulated insulin secretion in individuals with different glucose tolerance.
25872484 2015 miR-203 inhibits arecoline-induced epithelial-mesenchymal transition by regulating secreted frizzled-related protein 4 and transmembrane-4 L six family member 1 in oral submucous fibrosis.
25825452 2015 Epigenetic downregulation of SFRP4 contributes to epidermal hyperplasia in psoriasis.
25805505 2015 Number and brightness analysis of sFRP4 domains in live cells demonstrates vesicle association signal of the NLD domain and dynamic intracellular responses to Wnt3a.
25501511 2015 Secreted frizzled-related protein 4 and its implications in cancer and apoptosis.
25408147 2014 Association of secreted frizzled-related protein 4 (SFRP4) with type 2 diabetes in patients with stable coronary artery disease.
25322919 2015 Elevated secreted frizzled-related protein 4 in obesity: a potential role in adipose tissue dysfunction.
More...