Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
R01 Count 2
Funding $110,061.5
PubMed Score 7.93
PubTator Score 4.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.500 0.002
ependymoma -2.000 0.000
oligodendroglioma -1.300 0.012
osteosarcoma -1.690 0.000
glioblastoma -2.000 0.000
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.100 0.001
primitive neuroectodermal tumor -1.500 0.000
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -2.000 0.000
non primary Sjogren syndrome sicca 1.100 0.009

Synonym

Accession Q6F5E8 B8X2Z3
Symbols RLTPR
LRRC16C
CARMIL2b

Gene

Gene RIF (2)

PMID Text
26578515 Data suggest that CARMIL2 displays two localization patterns in cells; one coincides with vimentin intermediate filaments, and the other coincides with cell membrane at leading edge of migrating cells.
26466680 On the basis of these results, we propose a model in which dynamic vimentin filaments target CARMIL2 to critical membrane-associated locations, where CARMIL2 regulates CP, and thus actin assembly, to create cell protrusions

AA Sequence

MAQTPDGISCELRGEITRFLWPKEVELLLKTWLPGEGAVQNHVLALLRWRAYLLHTTCLPLRVDCTFSYL      1 - 70
EVQAMALQETPPQVTFELESLRELVLEFPGVAALEQLAQHVAAAIKKVFPRSTLGKLFRRPTPASMLARL     71 - 140
ERSSPSESTDPCSPCGGFLETYEALCDYNGFPFREEIQWDVDTIYHRQGCRHFSLGDFSHLGSRDLALSV    141 - 210
AALSYNLWFRCLSCVDMKLSLEVSEQILHMMSQSSHLEELVLETCSLRGDFVRRLAQALAGHSSSGLREL    211 - 280
SLAGNLLDDRGMTALSRHLERCPGALRRLSLAQTGLTPRGMRALGRALATNAAFDSTLTHLDLSGNPGAL    281 - 350
GASEDSGGLYSFLSRPNVLSFLNLAGTDTALDTVRGCSVGGWMTGRADWRAGRGGLGPPAGVANSLPPQL    351 - 420
FAAVSRGCCTSLTHLDASRNVFSRTKSRAAPAALQLFLSRARTLRHLGLAGCKLPPDALRALLDGLALNT    421 - 490
HLRDLHLDLSACELRSAGAQVIQDLVCDAGAVSSLDLADNGFGSDMVTLVLAIGRSRSLRHVALGRNFNV    491 - 560
RCKETLDDVLHRIVQLMQDDDCPLQSLSVAESRLKLGASVLLRALATNPNLTALDISGNAMGDAGAKLLA    561 - 630
KALRVNSRLRSVVWDRNHTSALGLLDVAQALEQNHSLKAMPLPLNDVAQAQRSRPELTARAVHQIQACLL    631 - 700
RNNRADPASSDHTTRLQPLGLVSDPSEQEVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSL    701 - 770
SILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQATLDTARSLCPQMLQGSSWREQLEGVL    771 - 840
AGSRGLPELLPEQLLQDAFTRLRDMRLSITGTLAESIVAQALAGLSAARDQLVESLAQQATVTMPPALPA    841 - 910
PDGGEPSLLEPGELEGLFFPEEKEEEKEKDDSPPQKWPELSHGLHLVPFIHSAAEEAEPEPELAAPGEDA    911 - 980
EPQAGPSARGSPSPAAPGPPAGPLPRMDLPLAGQPLRHPTRARPRPRRQHHHRPPPGGPQVPPALPQEGN    981 - 1050
GLSARVDEGVEEFFSKRLIQQDRLWAPEEDPATEGGATPVPRTLRKKLGTLFAFKKPRSTRGPRTDLETS   1051 - 1120
PGAAPRTRKTTFGDLLRPPTRPSRGEELGGAEGDTSSPDPAGRSRPRYTRDSKAYSMILLPAEEEATLGA   1121 - 1190
RPDKRRPLERGETELAPSFEQRVQVMLQRIGVSRGSGGAEGKRKQSKDGEIKKAGSDGDIMDSSTEAPPI   1191 - 1260
SIKSRTHSVSADPSCRPGPGSQGPESATWKTLGQQLNAELRSRGWGQQDGPGPPSPGQSPSPCRTSPSPD   1261 - 1330
SLGLPEDPCLGPRNEDGQLRPRPLSAGRRAVSVHEDQLQAPAERPLRLQRSPVLKRRPKLEAPPSPSLGS   1331 - 1400
GLGTEPLPPQPTEPSSPERSPPSPATDQRGGGPNP                                      1401 - 1435
//

Text Mined References (13)

PMID Year Title
26578515 2016 Cell Migration and Invadopodia Formation Require a Membrane-binding Domain of CARMIL2.
26466680 2015 CARMIL2 is a novel molecular connection between vimentin and actin essential for cell migration and invadopodia formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19846667 2009 Distinct roles for CARMIL isoforms in cell migration.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...