Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.70
PubTator Score 9.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.54969298305551E-5
medulloblastoma, large-cell 6234 6.41438916763603E-4
adrenocortical carcinoma 1427 0.00482509222786243
group 3 medulloblastoma 2254 0.00787805022382186
osteosarcoma 7933 0.00942813405422261
astrocytic glioma 2241 0.012726484014152
spina bifida 1064 0.0366642971409801
Disease Target Count Z-score Confidence
Radiculopathy 15 3.222 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.300 0.013
osteosarcoma 1.375 0.009
group 3 medulloblastoma -1.400 0.008
medulloblastoma, large-cell -1.300 0.001
adrenocortical carcinoma -1.125 0.005
spina bifida -1.824 0.037
ovarian cancer 1.400 0.000

Synonym

Accession Q6EMK4 Q6UXL4 Q6UXL5 Q96CX1
Symbols SLITL2

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
26157350 confirmed for the first time that HepG2-derived VASN can be transferred to human umbilical vein endothelial cells (HUVECs) via receptor mediated endocytosis of exosomes, at least in part through HSPGs
15247411 results suggest that down-regulation of vasorin expression contributes to neointimal formation after vascular injury and that vasorin modulates cellular responses to pathological stimuli in the vessel wall [vasorin]

AA Sequence

MCSRVPLLLPLLLLLALGPGVQGCPSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVFENGITMLDAG      1 - 70
SFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLRRLERLYLGKNRIRHIQ     71 - 140
PGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNSLLALEPGILDTANVEALRLAGLGLQQLDEG    141 - 210
LFSRLRNLHDLDVSDNQLERVPPVIRGLRGLTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALP    211 - 280
GDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGCP    281 - 350
ATTTTATVPTTRPVVREPTALSSSLAPTWLSPTEPATEAPSPPSTAPPTVGPVPQPQDCPPSTCLNGGTC    351 - 420
HLGTRHHLACLCPEGFTGLYCESQMGQGTRPSPTPVTPRPPRSLTLGIEPVSPTSLRVGLQRYLQGSSVQ    421 - 490
LRSLRLTYRNLSGPDKRLVTLRLPASLAEYTVTQLRPNATYSVCVMPLGPGRVPEGEEACGEAHTPPAVH    491 - 560
SNHAPVTQAREGNLPLLIAPALAAVLLAALAAVGAAYCVRRGRAMAAAAQDKGQVGPGAGPLELEGVKVP    561 - 630
LEPGPKATEGGGEALPSGSECEVPLMGFPGPGLQSPLHAKPYI                               631 - 673
//

Text Mined References (18)

PMID Year Title
26157350 2015 Exosomal transfer of vasorin expressed in hepatocellular carcinoma cells promotes migration of human umbilical vein endothelial cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21170088 2011 ADAM17 (TACE) regulates TGF? signaling through the cleavage of vasorin.
21082674 2010 Comprehensive analysis of low-abundance proteins in human urinary exosomes using peptide ligand library technology, peptide OFFGEL fractionation and nanoHPLC-chip-MS/MS.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
More...