Property Summary

NCBI Gene PubMed Count 17
Grant Count 10
Funding $910,566.19
PubMed Score 4.98
PubTator Score 31.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 1.500 0.000
psoriasis -1.900 0.000
osteosarcoma -2.035 0.000
lung cancer 1.100 0.006
ovarian cancer -1.500 0.000

Gene RIF (3)

PMID Text
24791901 this study has performed exome sequencing in 28 individuals with a similar disease phenotype and subsequently used a casecontrol approach to identify mutations in TTLL5 as a cause of recessive retinal dystrophy.
20374646 This study indicates that a physiological function of STAMP in several settings is to modify cell growth rates in a manner that can be independent of steroid hormones.
17116691 STAMP is an important new, downstream component of GR action in both gene activation and gene repression.

AA Sequence

MPIVMARDLEETASSSEDEEVISQEDHPCIMWTGGCRRIPVLVFHADAILTKDNNIRVIGERYHLSYKIV      1 - 70
RTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIR     71 - 140
MQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRY    141 - 210
INNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGDYV    211 - 280
SCDDPEVEDYGNKWSMSAMLRYLKQEGRDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELY    281 - 350
GFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRASTRPIYPTFESSRR    351 - 420
NPFQKPQRCRPLSASDAEMKNLVGSAREKGPGKLGGSVLGLSMEEIKVLRRVKEENDRRGGFIRIFPTSE    421 - 490
TWEIYGSYLEHKTSMNYMLATRLFQDRMTADGAPELKIESLNSKAKLHAALYERKLLSLEVRKRRRRSSR    491 - 560
LRAMRPKYPVITQPAEMNVKTETESEEEEEVALDNEDEEQEASQEESAGFLRENQAKYTPSLTALVENTP    561 - 630
KENSMKVREWNNKGGHCCKLETQELEPKFNLMQILQDNGNLSKMQARIAFSAYLQHVQIRLMKDSGGQTF    631 - 700
SASWAAKEDEQMELVVRFLKRASNNLQHSLRMVLPSRRLALLERRRILAHQLGDFIIVYNKETEQMAEKK    701 - 770
SKKKVEEEEEDGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASVFLGTHSKISKNNNNYSDSGAKGDH    771 - 840
PETIMEEVKIKPPKQQQTTEIHSDKLSRFTTSAEKEAKLVYSNSSSGPTATLQKIPNTHLSSVTTSDLSP    841 - 910
GPCHHSSLSQIPSAIPSMPHQPTILLNTVSASASPCLHPGAQNIPSPTGLPRCRSGSHTIGPFSSFQSAA    911 - 980
HIYSQKLSRPSSAKAGSCYLNKHHSGIAKTQKEGEDASLYSKRYNQSMVTAELQRLAEKQAARQYSPSSH    981 - 1050
INLLTQQVTNLNLATGIINRSSASAPPTLRPIISPSGPTWSTQSDPQAPENHSSSPGSRSLQTGGFAWEG   1051 - 1120
EVENNVYSQATGVVPQHKYHPTAGSYQLQFALQQLEQQKLQSRQLLDQSRARHQAIFGSQTLPNSNLWTM   1121 - 1190
NNGAGCRISSATASGQKPTTLPQKVVPPPSSCASLVPKPPPNHEQVLRRATSQKASKGSSAEGQLNGLQS   1191 - 1260
SLNPAAFVPITSSTDPAHTKI                                                    1261 - 1281
//

Text Mined References (21)

PMID Year Title
25959773 2015 Multivalent Microtubule Recognition by Tubulin Tyrosine Ligase-like Family Glutamylases.
24791901 2014 Biallelic variants in TTLL5, encoding a tubulin glutamylase, cause retinal dystrophy.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
22493317 2012 CSAP localizes to polyglutamylated microtubules and promotes proper cilia function and zebrafish development.
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20374646 2010 STAMP alters the growth of transformed and ovarian cancer cells.
19416867 2009 The transcriptome of human CD34+ hematopoietic stem-progenitor cells.
18045879 2008 Polyglutamylation is a post-translational modification with a broad range of substrates.
More...