Property Summary

NCBI Gene PubMed Count 18
Grant Count 28
R01 Count 15
Funding $2,035,670.22
PubMed Score 27.94
PubTator Score 16.45

Knowledge Summary

Patent

No data available

Gene RIF (6)

PMID Text
26129889 This study showed a genetic association between Dectin-2 and pulmonary cryptococcosis.
25659141 human plasmacytoid dendritic cells directly recognize A. fumigatus hyphae via Dectin-2
24129160 our data show a requirement for Dectin-2 in alveolar macrophage induction of cysteinyl leukotrienes and in the initiation of airway inflammation.
23606632 The Dectin-2 possess a single extracellular conserved C-type lectin-like domain and are capable of mediating intracellular signalling either directly, through integral signalling domains, or indirectly, by associating with signalling adaptor molecules.
21283787 Thus, dectin-1 and dectin-2 control adaptive T(H)-17 immunity to fungi via Malt1-dependent activation of c-Rel.
15810886 human DECTIN-2 has a role in innate immunity

AA Sequence

MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEG      1 - 70
TKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGL     71 - 140
SDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL     141 - 209
//

Text Mined References (20)

PMID Year Title
26129889 2015 Dectin-2 polymorphism associated with pulmonary cryptococcosis in HIV-uninfected Chinese patients.
25659141 2015 Recognition of Aspergillus fumigatus hyphae by human plasmacytoid dendritic cells is mediated by dectin-2 and results in formation of extracellular traps.
24362892 2014 Activation of neutrophils by autocrine IL-17A-IL-17RC interactions during fungal infection is regulated by IL-6, IL-23, ROR?t and dectin-2.
24129160 2014 Dectin-2 sensing of house dust mite is critical for the initiation of airway inflammation.
23932568 2013 Systems biology of host-mycobiota interactions: dissecting Dectin-1 and Dectin-2 signalling in immune cells with DC-ATLAS.
23928558 Dectin-2 is predominately macrophage restricted and exhibits conspicuous expression during Aspergillus fumigatus invasion in human lung.
23911656 2013 C-type lectin receptors Dectin-3 and Dectin-2 form a heterodimeric pattern-recognition receptor for host defense against fungal infection.
23606632 2013 The Dectin-2 family of C-type lectin-like receptors: an update.
23573288 2013 Lectin-dependent enhancement of Ebola virus infection via soluble and transmembrane C-type lectin receptors.
21677049 2011 Dectin-1 and Dectin-2 in innate immunity against fungi.
More...