Property Summary

NCBI Gene PubMed Count 20
PubMed Score 33.33
PubTator Score 16.45

Knowledge Summary

Patent

No data available

Gene RIF (8)

AA Sequence

MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEG      1 - 70
TKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGL     71 - 140
SDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL     141 - 209
//

Text Mined References (22)

PMID Year Title