Property Summary

NCBI Gene PubMed Count 56
Grant Count 2
Funding $27,606
PubMed Score 62.52
PubTator Score 90.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.953 0.000

Gene RIF (60)

PMID Text
25189908 SUMO4 M55V polymorphism and type-2 diabetes were significantly associated with a possible SUMO4 region to type-2 diabetes susceptibility.
23042402 No association between SUMO4 gene polymorphisms and acoronary artery disease with and without type 2 diabetes mellitus.
22936652 study demonstrates significant associations of SUMO4 M55V polymorphism with type 1 diabetes mellitus in Asian and Caucasian population and with type 2 diabetes mellitus in Asian population
22884980 This meta-analysis indicates that the SUMO4 M55V polymorphism confers susceptibility to type I diabetes in Asians and Europeans.
22425950 the association between small ubiquitin-like modifier 4 (SUMO4) gene polymorphisms and type 2 diabetes mellitus
21906435 Letter: report SUMO4 polymorphisms associated with protective effect in Tunisian rheumatoid arthritis patients.
21901353 The C438T polymorphism in the SUMO4 gene is associated with significantly increased risk of papulopustular skin lesions in HLA-B51-positive Behcet's disease patients.
21671169 SUMO4 Met55Val variant was associated with increased insulin resistance in Chinese patients with newly diagnosed type 2 diabetes.
21158221 SUMO4 gene M55V variant is associated with the genetic susceptibility of type 1 diabetes mellitus (T1D) in Chinese children.
20868570 SUMO4 gene polymorphisms may be involved in the development of skin lesions, vascular Behcet's disease, as well as the severity of the disease.
More...

AA Sequence

MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFGGQPISGT      1 - 70
DKPAQLEMEDEDTIDVFQQPTGGVY                                                  71 - 95
//

Text Mined References (57)

PMID Year Title
25189908 Association of SUMO4 M55V and -94ins/del gene variants with type-2 diabetes.
23042402 2012 [Association between SUMO4 polymorphisms and coronary artery disease with and without type 2 diabetes mellitus].
22936652 2012 Polymorphism M55V in gene encoding small ubiquitin-like modifier 4 (SUMO4) protein associates with susceptibility to type 1 (and type 2) diabetes.
22884980 2012 Association between the SUMO4 M55V (A163G) polymorphism and susceptibility to type 1 diabetes: a meta-analysis.
22425950 2012 [Association between SUMO4 polymorphisms and type 2 diabetes mellitus].
21906435 Association of small ubiquitin-like modifier 4 gene polymorphisms with rheumatoid arthritis in a Tunisian population.
21901353 2012 SUMO4 C438T polymorphism is associated with papulopustular skin lesion in Korean patients with Behçet's disease.
21671169 2011 Association of SUMO4 Met55Val variation with increased insulin resistance in newly diagnosed type 2 diabetes in a Chinese population.
21158221 2010 Association of SUMO4 M55V polymorphism with type 1 diabetes in Chinese children.
20868570 Association of small ubiquitin-like modifier 4 (SUMO4) polymorphisms in a Tunisian population with Behçet's disease.
More...