Property Summary

NCBI Gene PubMed Count 56
PubMed Score 62.52
PubTator Score 90.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7933 4.9e-08
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 104 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 4.243 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.953 4.9e-08

Gene RIF (60)

PMID Text
25189908 SUMO4 M55V polymorphism and type-2 diabetes were significantly associated with a possible SUMO4 region to type-2 diabetes susceptibility.
23042402 No association between SUMO4 gene polymorphisms and acoronary artery disease with and without type 2 diabetes mellitus.
22936652 study demonstrates significant associations of SUMO4 M55V polymorphism with type 1 diabetes mellitus in Asian and Caucasian population and with type 2 diabetes mellitus in Asian population
22884980 This meta-analysis indicates that the SUMO4 M55V polymorphism confers susceptibility to type I diabetes in Asians and Europeans.
22425950 the association between small ubiquitin-like modifier 4 (SUMO4) gene polymorphisms and type 2 diabetes mellitus
21906435 Letter: report SUMO4 polymorphisms associated with protective effect in Tunisian rheumatoid arthritis patients.
21901353 The C438T polymorphism in the SUMO4 gene is associated with significantly increased risk of papulopustular skin lesions in HLA-B51-positive Behcet's disease patients.
21671169 SUMO4 Met55Val variant was associated with increased insulin resistance in Chinese patients with newly diagnosed type 2 diabetes.
21158221 SUMO4 gene M55V variant is associated with the genetic susceptibility of type 1 diabetes mellitus (T1D) in Chinese children.
20868570 SUMO4 gene polymorphisms may be involved in the development of skin lesions, vascular Behcet's disease, as well as the severity of the disease.
20728233 The SUMO4 gene single nucleotide polymorphism variant is not associated with susceptibility of the type 2 diabetes polymorphism.
20728233 Observational study of gene-disease association. (HuGE Navigator)
20518843 Meta-analysis of gene-disease association. (HuGE Navigator)
20448286 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19956095 total of 2317 families were genotyped for 15 SNPs in the SUMO4 region.
19915388 This study suggests that in Taiwan the SUMO4 Met 55Val polymorphism is associated with susceptibility to T2DM and Type 2 diabetic patients with GG genotype have worse glycemic control.
19915388 Observational study of gene-disease association. (HuGE Navigator)
19410319 Association of the polymorphism of SUMO4 with risk of coronary heart disease in type 2 diabetes is suggested.
19410319 Observational study of gene-disease association. (HuGE Navigator)
19222990 SUMO4 may act as a negative feedback regulator to prevent excessive activation of NFkappaB.
19122825 This study examines whether small ubiquitin-like modifier 4 (SUMO4) polymorphisms were associated with Vogt-Koyanagi-Harada (VKH) syndrome in the Chinese Han population.
19122825 Observational study of gene-disease association. (HuGE Navigator)
18708028 These data not only confirmed previously published data, but also provided additional evidence suggesting a role for SUMO4 sumoylation in the regulation of intracellular stress.
18657476 SUMO4 +438 C allele is associated with susceptibility to Behcet's Disease (BD) in HLA-B51 negative Chinese Han patients, while the AGAT haplotype is protectively associated with BD in HLA-B51 negative patients
18466531 Observational study of gene-disease association. (HuGE Navigator)
18466472 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18330586 no associations of the SUMO4 rs237025 A>G polymorphism with the susceptibility of psoriasis were detected.
18330586 Observational study of gene-disease association. (HuGE Navigator)
17990297 we will update the genetic evidence supporting SUMO4 as a T1D susceptibility gene and discuss the possible explanations for the discrepant associations observed in Caucasians vs Asians.[review]
17926234 data indicate that the M55V polymorphism in the small ubiquitin-like protein 4(SUMO4) gene is associated with a reduced risk of diabetic retinopathy in type 1 diabetes
17926234 Observational study of gene-disease association. (HuGE Navigator)
17660269 reported a positive association of the SUMO4 M55V variant with diabetic nephropathy in an Asian cohort of 430 patients with type 2 diabetes
17558709 study of the prevalence of four polymorphisms,CTLA-4 -318 C/T, 159 C/T, 3' STR and SUMO4 163 AG in latent autoimmune diabetes in adults; no association with either of the polymorphisms has been found
17554341 Observational study of gene-disease association. (HuGE Navigator)
17554341 we conclude that SUMO4 M55V is associated with type I diabetes melitus in association with high-risk HLA-DR3 and DR4, but not by itself.
17459725 SUMO4 protein appears to be either in extremely low abundance in human kidney or HEK293 cells or it is not present at all.It remains possible that SUMO4 protein is more abundant in other cell types or can be induced by hormonal or environmental challenges
17452059 Observational study of gene-disease association. (HuGE Navigator)
17374705 Observational study of gene-disease association. (HuGE Navigator)
17374705 contribution of the SUMO4 Met55Val polymorphism to both type 1 and type 2 diabetes susceptibility in the Japanese population
17373940 Observational study of gene-disease association. (HuGE Navigator)
17373940 Our results show that Asian-Indians with T1DM are different from other Asian populations. Asian-Indians show more similarity to Caucasians with respect to the association of SUMO4 M55V variant in T1DM.
17229939 Observational study of gene-disease association. (HuGE Navigator)
17229939 SUMO4 gene methionine-valine variant is associated with severity of diabetic nephropathy in patients with type 2 diabetes.
17130565 Observational study of gene-disease association. (HuGE Navigator)
17130565 No significant association was found between SUMO4 M55V and LADA.
17130563 Genetic and functional evidence is provided supporting SUMO4 as a type 1 diabetes mellitus susceptibility gene.
17130532 Observational study of gene-disease association. (HuGE Navigator)
17130530 Meta-analysis of gene-disease association. (HuGE Navigator)
16821265 Observational study of gene-disease association. (HuGE Navigator)
16755651 Observational study of gene-disease association. (HuGE Navigator)
16755651 SUMO4 SNP did not significantly influence predisposition to and features of rheumatoid artritis, in contrast to previous genetic and functional evidence that suggested its involvement.
16735488 results indicate that the small ubiquitin-like protein 4(SUMO4) is a more common autoimmune disease gene and a supplementary risk factor to type 1 diabetes
16306380 Observational study of gene-disease association. (HuGE Navigator)
16306380 The M55V polymorphism was significantly associated with type 1 diabetes in Asian populations .
16249223 Observational study of gene-disease association. (HuGE Navigator)
16236267 SUMO4 sumoylation may play an important role in the regulation of intracellular stress
16159953 Observational study of gene-disease association. (HuGE Navigator)
15730420 Observational study of gene-disease association. (HuGE Navigator)
15247916 we report evidence for an association between T1D and multiple single-nucleotide polymorphisms in 197 kb of genomic DNA in the IDDM5 interval.
12901503 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFGGQPISGT      1 - 70
DKPAQLEMEDEDTIDVFQQPTGGVY                                                  71 - 95
//

Text Mined References (57)

PMID Year Title
25189908 Association of SUMO4 M55V and -94ins/del gene variants with type-2 diabetes.
23042402 2012 [Association between SUMO4 polymorphisms and coronary artery disease with and without type 2 diabetes mellitus].
22936652 2012 Polymorphism M55V in gene encoding small ubiquitin-like modifier 4 (SUMO4) protein associates with susceptibility to type 1 (and type 2) diabetes.
22884980 2012 Association between the SUMO4 M55V (A163G) polymorphism and susceptibility to type 1 diabetes: a meta-analysis.
22425950 2012 [Association between SUMO4 polymorphisms and type 2 diabetes mellitus].
21906435 Association of small ubiquitin-like modifier 4 gene polymorphisms with rheumatoid arthritis in a Tunisian population.
21901353 2012 SUMO4 C438T polymorphism is associated with papulopustular skin lesion in Korean patients with Behçet's disease.
21671169 2011 Association of SUMO4 Met55Val variation with increased insulin resistance in newly diagnosed type 2 diabetes in a Chinese population.
21158221 2010 Association of SUMO4 M55V polymorphism with type 1 diabetes in Chinese children.
20868570 Association of small ubiquitin-like modifier 4 (SUMO4) polymorphisms in a Tunisian population with Behçet's disease.
20728233 2010 No association of the SUMO4 polymorphism M55V variant in type 2 diabetes in Iranian subjects.
20518843 2010 Association of SUMO4 M55V polymorphism with susceptibility to autoimmune and inflammatory diseases: a meta-analysis.
20448286 2010 Association between anti-tumour necrosis factor treatment response and genetic variants within the TLR and NF{kappa}B signalling pathways.
19956095 2009 Analyses of multiple single-nucleotide polymorphisms in the SUMO4/IDDM5 region in affected sib-pair families with type I diabetes.
19915388 2010 Small ubiquitin-like modifier-4 Met55Val polymorphism is associated with glycemic control of Type 2 diabetes mellitus in Taiwan.
19410319 2009 SUMO4 Met55Val polymorphism is associated with coronary heart disease in Japanese type 2 diabetes individuals.
19222990 2009 Characterization of a negative feedback network between SUMO4 expression and NFkappaB transcriptional activity.
19122825 2008 Small ubiquitin-like modifier 4 (SUMO4) polymorphisms and Vogt-Koyanagi-Harada (VKH) syndrome in the Chinese Han population.
18708028 2008 A stress-dependent SUMO4 sumoylation of its substrate proteins.
18657476 2008 SUMO4 gene polymorphisms in Chinese Han patients with Behcet's disease.
18466531 2007 Case-control association analysis of rheumatoid arthritis with candidate genes using related cases.
18466472 2007 Constructing gene association networks for rheumatoid arthritis using the backward genotype-trait association (BGTA) algorithm.
18330586 2008 Association study of NFKB1 and SUMO4 polymorphisms in Chinese patients with psoriasis vulgaris.
17990297 2008 SUMO4 and its role in type 1 diabetes pathogenesis.
17926234 2008 A M55V polymorphism in the SUMO4 gene is associated with a reduced prevalence of diabetic retinopathy in patients with Type 1 diabetes.
17660269 2007 Comment on: Lin et al. (2007) SUMO4 M55V variant is associated with diabetic nephropathy in type 2 diabetes: Diabetes 56: 1177-1180.
17558709 2007 No evidence of association of CTLA-4 -318 C/T, 159 C/T, 3' STR and SUMO4 163 AG polymorphism with autoimmune diabetes.
17554341 2007 SUMO4 M55V polymorphism affects susceptibility to type I diabetes in HLA DR3- and DR4-positive Swedish patients.
17459725 2007 Affinity chromatography of native SUMO proteins using His-tagged recombinant UBC9 bound to Co2+-charged talon resin.
17452059 2007 Genetics of type 1 diabetes in Asian and Caucasian populations.
17374705 2007 Association of small ubiquitin-like modifier 4 (SUMO4) variant, located in IDDM5 locus, with type 2 diabetes in the Japanese population.
17373940 2007 No association of SUMO4 M55V with autoimmune diabetes in Asian-Indian patients.
17229939 2007 SUMO4 M55V variant is associated with diabetic nephropathy in type 2 diabetes.
17130565 2006 Association of SUMO4 M55V polymorphism with autoimmune diabetes in Latvian patients.
17130563 2006 Genetic and functional evidence supporting SUMO4 as a type 1 diabetes susceptibility gene.
17130532 2006 Genetics of type 1 diabetes: similarities and differences between Asian and Caucasian populations.
17130530 2006 Association of SUMO4, as a candidate gene for IDDM5, with susceptibility to type 1 diabetes in Asian populations.
16821265 2006 SLC22A4, RUNX1, and SUMO4 polymorphisms are not associated with rheumatoid arthritis: a case-control study in a Spanish population.
16755651 2006 SUMO4 and MAP3K7IP2 single nucleotide polymorphisms and susceptibility to rheumatoid arthritis.
16735488 2006 Evidence for the role of small ubiquitin-like modifier 4 as a general autoimmunity locus in the Japanese population.
16306380 2005 Genetic heterogeneity in association of the SUMO4 M55V variant with susceptibility to type 1 diabetes.
16249223 2006 Study of the role of functional variants of SLC22A4, RUNX1 and SUMO4 in systemic lupus erythematosus.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16198310 2005 A proline-90 residue unique to SUMO-4 prevents maturation and sumoylation.
16159953 2005 The type 1 diabetes susceptibility gene SUMO4 at IDDM5 is not associated with susceptibility to rheumatoid arthritis or juvenile idiopathic arthritis.
15730420 2005 No association of the codon 55 methionine to valine polymorphism in the SUMO4 gene with Graves' disease.
15678137 2005 Assessing the validity of the association between the SUMO4 M55V variant and risk of type 1 diabetes.
15678135 2005 Assessing the validity of the association between the SUMO4 M55V variant and risk of type 1 diabetes.
15678134 2005 Assessing the validity of the association between the SUMO4 M55V variant and risk of type 1 diabetes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247916 2004 A functional variant of SUMO4, a new I kappa B alpha modifier, is associated with type 1 diabetes.
15123604 2004 A M55V polymorphism in a novel SUMO gene (SUMO-4) differentially activates heat shock transcription factors and is associated with susceptibility to type I diabetes mellitus.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12901503 2001 Preliminary studies on associations of IDDM3, IDDM4, IDDM5 and IDDM8 with IDDM in Chengdu population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8733139 1996 Confirmation of three susceptibility genes to insulin-dependent diabetes mellitus: IDDM4, IDDM5 and IDDM8.
8072542 1994 A genome-wide search for human type 1 diabetes susceptibility genes.