Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.11
PubTator Score 21.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.2e-09

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -2.300 1.2e-09

Gene RIF (21)

AA Sequence

MATPARAPESPPSADPALVAGPAEEAECPPPRQPQPAQNVLAAPRLRAPSSRGLGAAEFGGAAGNVEAPG      1 - 70
ETFAQRVSWGPAESPPGSFSSSSLGAPLPSRTLFPSLEGDFDSVTFASVLRASGRRACCGRAVPLPGQKI     71 - 140
HLQIARQR                                                                  141 - 148
//

Text Mined References (28)

PMID Year Title