Property Summary

NCBI Gene PubMed Count 68
PubMed Score 154.12
PubTator Score 107.11

Knowledge Summary

Patent

No data available

Gene RIF (67)

AA Sequence

MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEKGVLVSQNYTL      1 - 70
PCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTI     71 - 140
SQQFSECMDLALKSLTSGAQQATT                                                  141 - 164
//

Text Mined References (69)

PMID Year Title