Property Summary

NCBI Gene PubMed Count 57
Grant Count 12
R01 Count 8
Funding $885,878
PubMed Score 132.16
PubTator Score 107.11

Knowledge Summary

Patent

No data available

Gene RIF (56)

PMID Text
26944931 IL-31 affects keratinocyte differentiation in multiple ways and the IL-1 cytokine network is a major downstream effector of IL-31 signaling in deregulating the physical skin barrier.
26449657 An increase of IL-31 serum levels in postmenopausal women with decreased bone mineral density, is shown.
26357000 a possible systemic involvement of IL-31 and the absence of a systemic involvement of IL-33 in allergic contact dermatitis.
26306032 crucial requirements for IL-31 signaling and its counter-regulation by SOCS3
26198770 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25756056 IL-31 is overexpressed in the lesional skin of LP but its expression does not correlate with intensity of pruritus.
25710085 In summary, TGF-beta1 and IL-31 were linked to progression from chronic hepatitis B to liver cirrhosis, and correlated well with the severity of disease.
25572240 the results suggest that IL-31 may be a candidate gene associated with the pathogenesis of rheumatoid arthritis
25534405 The results of this study suggest that the severity of atopic dermatitis in a Polish population is associated with some specific haplotypes of the IL-31 gene and renew questions concerning the role of IL-31 in pruritus in atopic dermatitis.
25488078 The results of our analyses regarding serum levels and receptor expression do not suggest a central role of IL-31 in Mycosis fungoides/Sezary syndrome pathogenesis.
More...

AA Sequence

MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEKGVLVSQNYTL      1 - 70
PCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTI     71 - 140
SQQFSECMDLALKSLTSGAQQATT                                                  141 - 164
//

Text Mined References (58)

PMID Year Title
26944931 2016 Control of the Physical and Antimicrobial Skin Barrier by an IL-31-IL-1 Signaling Network.
26449657 2015 Increased levels of interleukin 31 (IL-31) in osteoporosis.
26357000 2015 IL-31 and IL-33 circulating levels in allergic contact dermatitis.
26306032 2015 Prerequisites for Functional Interleukin 31 Signaling and Its Feedback Regulation by Suppressor of Cytokine Signaling 3 (SOCS3).
26198770 2015 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25756056 2015 IL-31 is overexpressed in lichen planus but its level does not correlate with pruritus severity.
25710085 2015 Elevated TGF-?1/IL-31 Pathway Is Associated with the Disease Severity of Hepatitis B Virus-Related Liver Cirrhosis.
25572240 2014 Polymorphisms of interleukin-31 are associated with anti-CCP levels in females with rheumatoid arthritis.
25534405 2015 The frequencies of haplotypes defined by three polymorphisms of the IL-31 gene: -1066, -2057, and IVS2+12 in Polish patients with atopic dermatitis.
25488078 2015 Analysis of the IL-31 pathway in Mycosis fungoides and Sézary syndrome.
More...