Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.55
PubTator Score 6.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -1.500 3.2e-07
chronic rhinosinusitis -1.207 2.7e-02
ependymoma 1.600 4.5e-02
fibroadenoma 1.800 4.9e-02
interstitial cystitis -2.000 1.5e-03
intraductal papillary-mucinous carcinoma... -1.100 4.8e-03
nasopharyngeal carcinoma -2.100 4.5e-05
ovarian cancer -1.400 1.2e-03
pancreatic ductal adenocarcinoma liver m... 1.310 1.1e-02

Gene RIF (7)

AA Sequence

MKFQGPLACLLLALCLGSGEAGPLQSGEESTGTNIGEALGHGLGDALSEGVGKAIGKEAGGAAGSKVSEA      1 - 70
LGQGTREAVGTGVRQVPGFGVADALGNRVGEAAHALGNTGHEIGRQAEDVIRHGADAVRGSWQGVPGHNG     71 - 140
AWETSGGHGIFGSQGGLGGQGQGNPGGLGTPWVHGYPGNSAGSFGMNPQGAPWGQGGNGGPPNFGTNTQG    141 - 210
AVAQPGYGSVRASNQNEGCTNPPPSGSGGGSSNSGGGSGSQSGSSGSGSNGDNNNGSSSGGSSSGSSSGG    211 - 280
SSGGSSGGSSGNSGGSRGDSGSESSWGSSTGSSSGNHGGSGGGNGHKPGCEKPGNEARGSGESGIQNSET    281 - 350
SPGMFNFDTFWKNFKSKLGFINWDAINKNQVPPPSTRALLYFSRLWEDFKQNTPFLNWKAIIEGADASSL    351 - 420
QKRAGRDDQNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASRVQPGLLQWVKFW                  421 - 476
//

Text Mined References (20)

PMID Year Title