Property Summary

Ligand Count 15
NCBI Gene PubMed Count 13
PubMed Score 15.31
PubTator Score 10.32

Knowledge Summary

Patent (1,735)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Gene RIF (1)

AA Sequence

MEHTHAHLAANSSLSWWSPGSACGLGFVPVVYYSLLLCLGLPANILTVIILSQLVARRQKSSYNYLLALA      1 - 70
AADILVLFFIVFVDFLLEDFILNMQMPQVPDKIIEVLEFSSIHTSIWITVPLTIDRYIAVCHPLKYHTVS     71 - 140
YPARTRKVIVSVYITCFLTSIPYYWWPNIWTEDYISTSVHHVLIWIHCFTVYLVPCSIFFILNSIIVYKL    141 - 210
RRKSNFRLRGYSTGKTTAILFTITSIFATLWAPRIIMILYHLYGAPIQNRWLVHIMSDIANMLALLNTAI    211 - 280
NFFLYCFISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDKNGKPIK    281 - 350
VSP                                                                       351 - 353
//

Text Mined References (15)

PMID Year Title