Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.22
PubTator Score 10.32

Knowledge Summary

Patent (1,735)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Gene RIF (1)

PMID Text
15845401 Molecular cloning of GPRg1, a Gq-coupled orphan receptor that is expressed in the brain.

AA Sequence

MEHTHAHLAANSSLSWWSPGSACGLGFVPVVYYSLLLCLGLPANILTVIILSQLVARRQKSSYNYLLALA      1 - 70
AADILVLFFIVFVDFLLEDFILNMQMPQVPDKIIEVLEFSSIHTSIWITVPLTIDRYIAVCHPLKYHTVS     71 - 140
YPARTRKVIVSVYITCFLTSIPYYWWPNIWTEDYISTSVHHVLIWIHCFTVYLVPCSIFFILNSIIVYKL    141 - 210
RRKSNFRLRGYSTGKTTAILFTITSIFATLWAPRIIMILYHLYGAPIQNRWLVHIMSDIANMLALLNTAI    211 - 280
NFFLYCFISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDKNGKPIK    281 - 350
VSP                                                                       351 - 353
//

Text Mined References (15)

PMID Year Title
26396690 2015 Identification and SAR of Glycine Benzamides as Potent Agonists for the GPR139 Receptor.
26349500 2015 GPR139, an Orphan Receptor Highly Enriched in the Habenula and Septum, Is Activated by the Essential Amino Acids L-Tryptophan and L-Phenylalanine.
24826842 2014 Computer-aided discovery of aromatic l-?-amino acids as agonists of the orphan G protein-coupled receptor GPR139.
24556202 2014 Copy number variation distribution in six monozygotic twin pairs discordant for schizophrenia.
24503482 2014 Sequence-structure based phylogeny of GPCR Class A Rhodopsin receptors.
23527680 2013 Genome-wide association study of inattention and hyperactivity-impulsivity measured as quantitative traits.
19525486 2009 Identification of surrogate agonists and antagonists for orphan G-protein-coupled receptor GPR139.
15845401 2005 Molecular cloning and characterization of a novel Gq-coupled orphan receptor GPRg1 exclusively expressed in the central nervous system.
15777626 2005 Nine new human Rhodopsin family G-protein coupled receptors: identification, sequence characterisation and evolutionary relationship.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...