Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

AA Sequence

MPEPAKFAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKRVHPDTGIWCKAMGIMNSFLNDI      1 - 70
FERIAGEASRLAHYNKRSTITSRRSRRPCACCCPASWPSTPCPRAPRRSPSTPAPSESLPGPGARSLPPS     71 - 140
LPPRVAGCFVSKGSFQGHLTPLVK                                                  141 - 164
//

Text Mined References (9)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
20194426 2010 Birth-and-death long-term evolution promotes histone H2B variant diversification in the male germinal cell line.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16283522 2005 Inhibition of core histones acetylation by carcinogenic nickel(II).
15527963 2004 Functional characterization of a human histone gene cluster duplication.
12757711 2003 Apoptotic phosphorylation of histone H2B is mediated by mammalian sterile twenty kinase.
12408966 2002 The human and mouse replication-dependent histone genes.
6326092 1984 Evidence for a human histone gene cluster containing H2B and H2A pseudogenes.