Property Summary

NCBI Gene PubMed Count 28
PubMed Score 14.66
PubTator Score 18.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.200 2.0e-07
astrocytic glioma -2.000 2.3e-03
Astrocytoma, Pilocytic -1.100 5.0e-05
atypical teratoid / rhabdoid tumor -2.300 5.7e-10
Chronic Lymphocytic Leukemia -1.980 1.2e-05
ependymoma -1.700 4.8e-03
glioblastoma -1.600 1.1e-09
group 3 medulloblastoma -1.300 7.2e-03
malignant mesothelioma 1.300 6.4e-07
medulloblastoma, large-cell -2.900 4.9e-05
non-small cell lung cancer -1.164 1.9e-19
oligodendroglioma -1.400 1.1e-02
osteosarcoma -1.527 4.6e-07
primitive neuroectodermal tumor -1.500 5.2e-03
subependymal giant cell astrocytoma -1.145 4.2e-02

Gene RIF (17)

AA Sequence

MWCLHCNSERTQSLLELELDSGVEGEAPSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEHTSVGAYGLYS      1 - 70
GPPGQQQRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDKQVEMLERKYGGRLVTRHAART     71 - 140
IQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSFEGPEKVHSSYFEGKQVSVTNDGSQLGALV    141 - 210
SPECGDLSEPTTLKSPAPSSDFADAITELEDAFSRQVKSLAESIDDALNCRSLHTEEAPALDAARARDTE    211 - 280
PQTALHGMDHRKLDEMTASYSDVTLYIDEEELSPPLPLSQAGDRPSSTESDLRLRAGGAAPDYWALAHKE    281 - 350
DKADTDTSCRSTPSLERQEQRLRVEHLPLLTIEPPSDSSVDLSDRSERGSLKRQSAYERSLGGQQGSPKH    351 - 420
GPHSGAPKSLPREEPELRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSNDTINCSSESS    421 - 490
SRDSLREQTLSKQTYHKEARNSWDSPAFSNDVIRKRHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVA    491 - 560
HFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEA    561 - 630
FSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREML    631 - 700
MGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQK    701 - 770
LGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLI    771 - 840
NFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNGTLSRACLDDS    841 - 910
YASGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEFQPFEPLQPSVLCS                     911 - 963
//

Text Mined References (35)

PMID Year Title