Property Summary

NCBI Gene PubMed Count 28
PubMed Score 13.24
PubTator Score 18.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Chronic Lymphocytic Leukemia -1.980 0.000
malignant mesothelioma 1.300 0.000
astrocytic glioma -2.000 0.002
ependymoma -1.700 0.005
oligodendroglioma -1.500 0.000
glioblastoma -2.100 0.000
osteosarcoma -1.527 0.000
medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -1.500 0.005
non-small cell lung cancer -1.164 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.145 0.042

Synonym

Accession Q6DN90 O94863 Q96D85
Symbols BRAG2
GEP100
ARFGEP100
ARF-GEP100

Gene

PDB

3QWM   4C0A  

Gene RIF (17)

PMID Text
26884337 both Arf6 activation through GluN2B-BRAG1 during early development and the transition from BRAG1- to BRAG2-dependent Arf6 signaling induced by the GluN2 subunit switch are critical for the development of mature glutamatergic synapses.
24902879 The EGFR-GEP100-Arf6 axis affected the prognosis of patients with primary lung adenocarcinoma.
24522833 Brag2 is essential for developmental and pathological angiogenesis by promoting endothelial cell sprouting through regulation of adhesion by beta1-integrin internalization and link for the first time the process of beta1-integrin endocytosis with angiogenesis.
24116160 Data show that co-overexpression of GEP100 and AMAP1 (ASAP1) correlates with rapidity of the local recurrence.
23747719 GEP100 regulates an Arf6/ERK/uPAR signaling cascade in EGF-induced breast cancer cell invasion.
22815487 BRAG2 acts at clathrin-coated pits to promote integrin internalization by activating Arf5 and suggest a previously unrecognized role for Arf5 in clathrin-mediated endocytosis of specific cargoes.
22701712 GEP100/Arf6 is required for epidermal growth factor-induced ERK/Rac1 signaling and cell migration in human hepatoma HepG2 cells.
22662237 GEP100 plays a significant role in pancreatic cancer invasion through regulating the expression of E-cadherin and the process of mesenchymal to epithelial transition (MET).
22613714 The PH domain and the interdomain linker of Brag2 may be targets for selectively regulating the activity of Brag2.
21966491 Cinical study indicates that co-overexpression of Her2 with GEP100 in primary lung adenocarcinomas of patients is correlated with the presence of their node-metastasis with a statistical significance.
More...

AA Sequence

MWCLHCNSERTQSLLELELDSGVEGEAPSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEHTSVGAYGLYS      1 - 70
GPPGQQQRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDKQVEMLERKYGGRLVTRHAART     71 - 140
IQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSFEGPEKVHSSYFEGKQVSVTNDGSQLGALV    141 - 210
SPECGDLSEPTTLKSPAPSSDFADAITELEDAFSRQVKSLAESIDDALNCRSLHTEEAPALDAARARDTE    211 - 280
PQTALHGMDHRKLDEMTASYSDVTLYIDEEELSPPLPLSQAGDRPSSTESDLRLRAGGAAPDYWALAHKE    281 - 350
DKADTDTSCRSTPSLERQEQRLRVEHLPLLTIEPPSDSSVDLSDRSERGSLKRQSAYERSLGGQQGSPKH    351 - 420
GPHSGAPKSLPREEPELRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSNDTINCSSESS    421 - 490
SRDSLREQTLSKQTYHKEARNSWDSPAFSNDVIRKRHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVA    491 - 560
HFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEA    561 - 630
FSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREML    631 - 700
MGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQK    701 - 770
LGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLI    771 - 840
NFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNGTLSRACLDDS    841 - 910
YASGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEFQPFEPLQPSVLCS                     911 - 963
//

Text Mined References (35)

PMID Year Title
27265506 2016 ARF6 Is an Actionable Node that Orchestrates Oncogenic GNAQ Signaling in Uveal Melanoma.
26884337 2016 Subunit-selective N-Methyl-d-aspartate (NMDA) Receptor Signaling through Brefeldin A-resistant Arf Guanine Nucleotide Exchange Factors BRAG1 and BRAG2 during Synapse Maturation.
24902879 2014 Epidermal growth factor receptor-GEP100-Arf6 axis affects the prognosis of lung adenocarcinoma.
24522833 2014 Brag2 differentially regulates ?1- and ?3-integrin-dependent adhesion in endothelial cells and is involved in developmental and pathological angiogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116160 2013 Co-overexpression of GEP100 and AMAP1 proteins correlates with rapid local recurrence after breast conservative therapy.
24058294 2013 Integrated conformational and lipid-sensing regulation of endosomal ArfGEF BRAG2.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23747719 2013 GEP100 regulates epidermal growth factor-induced MDA-MB-231 breast cancer cell invasion through the activation of Arf6/ERK/uPAR signaling pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...