Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.46
PubTator Score 20.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PANTHER Protein Class (1)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG

Gene RIF (3)

PMID Text
23898208 HIV-1 Tat downregulates the expression of Fc receptor-like 6 (FCRL6) in human primary T cells
20519654 Human FCRL6 receptor, selectively expressed by cytotoxic T and natural killer (NK) cells, directly binds the major histocompatibility complex (MHC) class II molecule HLA-DR.
18991291 FCRL6 is a distinct indicator of cytotoxic effector lymphocytes that is upregulated in diseases characterized by chronic immune stimulation.

AA Sequence

MLLWTAVLLFVPCVGKTVWLYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSM      1 - 70
GAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLR     71 - 140
SALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLT    141 - 210
LHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAEN    211 - 280
SVSRERSEPKKLSLKGSQVLFTPASNWLVPWLPASLLGLMVIAAALLVYVRSWRKAGPLPSQIPPTAPGG    281 - 350
EQCPLYANVHHQKGKDEGVVYSVVHRTSKRSEARSAEFTVGRKDSSIICAEVRCLQPSEVSSTEVNMRSR    351 - 420
TLQEPLSDCEEVLC                                                            421 - 434
//

Text Mined References (8)

PMID Year Title
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
20519654 2010 Cutting edge: FcR-like 6 is an MHC class II receptor.
18991291 2008 FCRL6 distinguishes mature cytotoxic lymphocytes and is upregulated in patients with B-cell chronic lymphocytic leukemia.
17273841 2007 The first avian Ig-like Fc receptor family member combines features of mammalian FcR and FCRL.
17213291 2007 FcRL6, a new ITIM-bearing receptor on cytolytic cells, is broadly expressed by lymphocytes following HIV-1 infection.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.