Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
Funding $98,094.25
PubMed Score 3.46
PubTator Score 20.93

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
23898208 HIV-1 Tat downregulates the expression of Fc receptor-like 6 (FCRL6) in human primary T cells
20519654 Human FCRL6 receptor, selectively expressed by cytotoxic T and natural killer (NK) cells, directly binds the major histocompatibility complex (MHC) class II molecule HLA-DR.
18991291 FCRL6 is a distinct indicator of cytotoxic effector lymphocytes that is upregulated in diseases characterized by chronic immune stimulation.

AA Sequence

MLLWTAVLLFVPCVGKTVWLYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSM      1 - 70
GAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLR     71 - 140
SALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLT    141 - 210
LHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAEN    211 - 280
SVSRERSEPKKLSLKGSQVLFTPASNWLVPWLPASLLGLMVIAAALLVYVRSWRKAGPLPSQIPPTAPGG    281 - 350
EQCPLYANVHHQKGKDEGVVYSVVHRTSKRSEARSAEFTVGRKDSSIICAEVRCLQPSEVSSTEVNMRSR    351 - 420
TLQEPLSDCEEVLC                                                            421 - 434
//

Text Mined References (8)

PMID Year Title
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
20519654 2010 Cutting edge: FcR-like 6 is an MHC class II receptor.
18991291 2008 FCRL6 distinguishes mature cytotoxic lymphocytes and is upregulated in patients with B-cell chronic lymphocytic leukemia.
17273841 2007 The first avian Ig-like Fc receptor family member combines features of mammalian FcR and FCRL.
17213291 2007 FcRL6, a new ITIM-bearing receptor on cytolytic cells, is broadly expressed by lymphocytes following HIV-1 infection.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.