Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.44
PubTator Score 1.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -2.300 3.2e-04
astrocytic glioma -2.600 1.7e-03
Astrocytoma, Pilocytic -1.500 2.0e-02
atypical teratoid / rhabdoid tumor -2.200 4.7e-04
cystic fibrosis 2.005 3.3e-05
ependymoma -2.400 4.7e-03
glioblastoma -2.300 4.6e-07
group 3 medulloblastoma -2.800 3.1e-03
hepatocellular carcinoma 1.100 8.9e-04
interstitial cystitis 1.900 4.7e-03
invasive ductal carcinoma -2.000 1.8e-02
lung carcinoma -1.300 7.9e-09
malignant mesothelioma -1.200 1.1e-05
medulloblastoma, large-cell -3.400 2.5e-06
non-small cell lung cancer -1.178 7.7e-08
oligodendroglioma -1.900 1.9e-02
osteosarcoma -1.678 1.7e-02
pancreatic cancer 1.400 4.3e-03
pancreatic carcinoma 1.400 4.3e-03
Pick disease -1.700 2.8e-02
pituitary cancer -1.600 9.0e-05
primitive neuroectodermal tumor -2.500 7.8e-04
sarcoidosis 1.500 4.4e-02
tuberculosis 2.200 2.8e-04
ulcerative colitis 2.300 2.5e-05

 GO Function (1)

Gene RIF (4)

AA Sequence

MEPRAAAAGEPEPPAASSSFQARLWKNLQLGVGRSKGGGGGRAGGPERRTADTPSPSPPPPVGTGNAPAR      1 - 70
GSGAGSRWSGFKKRKQVLDRVFSSSQPNLCCSSPEPLEPGGAGRAEQGSTLRRRIREHLLPAVKGPAAAS     71 - 140
GAAGGTPPGGRSPDSAPSSSSASSSLSSSPQPPPRGDRARDEGARRQGPGAHLCHQKSSSLPGTACLEQL    141 - 210
LEPPPPPAEPARSPAESRAPETGEEHGSSQKIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGG    211 - 280
TSDPYVKFKIGGKEVFRSKIIHKNLNPVWEEKACILVDHLREPLYIKVFDYDFGLQDDFMGSAFLDLTQL    281 - 350
ELNRPTDVTLTLKDPHYPDHDLGIILLSVILTPKEGESRDVTMLMRKSWKRSSKELSENEVVGSYFSVKS    351 - 420
LFWRTCGRPALPVLGFCRAELQNPYCKNVQFQTQSLRLSDLHRKSHLWRGIVSITLIEGRDLKAMDSNGL    421 - 490
SDPYVKFRLGHQKYKSKIMPKTLNPQWREQFDFHLYEERGGVIDITAWDKDAGKRDDFIGRCQVDLSALS    491 - 560
REQTHKLELQLEEGEGHLVLLVTLTASATVSISDLSVNSLEDQKEREEILKRYSPLRIFHNLKDVGFLQV    561 - 630
KVIRAEGLMAADVTGKSDPFCVVELNNDRLLTHTVYKNLNPEWNKVFTFNIKDIHSVLEVTVYDEDRDRS    631 - 700
ADFLGKVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIYLEIDVIFNAVKASLRTLIPKEQKYIEEENRLS    701 - 770
KQLLLRNFIRMKRCVMVLVNAAYYVNSCFDWDSPPRSLAAFVLFLFVVWNFELYMIPLVLLLLLTWNYFL    771 - 840
IISGKDNRQRDTVVEDMLEDEEEEDDKDDKDSEKKGFINKIYAIQEVCVSVQNILDEVASFGERIKNTFN    841 - 910
WTVPFLSWLAIVALCVFTAILYCIPLRYIVLVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQ    911 - 980
ELKPDPSHSPYKRKKNNLG                                                       981 - 999
//

Text Mined References (11)

PMID Year Title