Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.33
PubTator Score 1.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.001
pancreatic cancer 1.400 0.004
malignant mesothelioma -1.200 0.000
astrocytic glioma -3.900 0.001
ependymoma -3.900 0.000
oligodendroglioma -3.100 0.007
glioblastoma -3.600 0.000
osteosarcoma -1.678 0.017
medulloblastoma -3.400 0.000
cystic fibrosis 2.005 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -4.200 0.000
primitive neuroectodermal tumor -3.200 0.000
tuberculosis 2.200 0.000
non-small cell lung cancer -1.178 0.000
sarcoidosis 1.500 0.044
interstitial cystitis 2.700 0.000
pediatric high grade glioma -2.700 0.000
pilocytic astrocytoma -1.500 0.022
pancreatic carcinoma 1.400 0.004
lung carcinoma -1.300 0.000
Pick disease -1.700 0.028
invasive ductal carcinoma -2.000 0.018
ulcerative colitis 2.300 0.000
pituitary cancer -2.200 0.000

Synonym

Accession Q6DN14 Q6DN13 Q8N2W1 Q8NBA2 Q96LX0 Q9H6E8
Symbols

Gene

Gene RIF (3)

PMID Text
26195140 MCTP1 was observed on synaptic vesicles in neuronal cell bodies and pre-synaptic axon terminals.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15528213 MCTPs are evolutionarily conserved C2 domain proteins that are unusual in that the C2 domains are anchored in the membrane by two closely spaced transmembrane regions and represent Ca(2+)-binding but not phospholipid-binding modules

AA Sequence

MEPRAAAAGEPEPPAASSSFQARLWKNLQLGVGRSKGGGGGRAGGPERRTADTPSPSPPPPVGTGNAPAR      1 - 70
GSGAGSRWSGFKKRKQVLDRVFSSSQPNLCCSSPEPLEPGGAGRAEQGSTLRRRIREHLLPAVKGPAAAS     71 - 140
GAAGGTPPGGRSPDSAPSSSSASSSLSSSPQPPPRGDRARDEGARRQGPGAHLCHQKSSSLPGTACLEQL    141 - 210
LEPPPPPAEPARSPAESRAPETGEEHGSSQKIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGG    211 - 280
TSDPYVKFKIGGKEVFRSKIIHKNLNPVWEEKACILVDHLREPLYIKVFDYDFGLQDDFMGSAFLDLTQL    281 - 350
ELNRPTDVTLTLKDPHYPDHDLGIILLSVILTPKEGESRDVTMLMRKSWKRSSKELSENEVVGSYFSVKS    351 - 420
LFWRTCGRPALPVLGFCRAELQNPYCKNVQFQTQSLRLSDLHRKSHLWRGIVSITLIEGRDLKAMDSNGL    421 - 490
SDPYVKFRLGHQKYKSKIMPKTLNPQWREQFDFHLYEERGGVIDITAWDKDAGKRDDFIGRCQVDLSALS    491 - 560
REQTHKLELQLEEGEGHLVLLVTLTASATVSISDLSVNSLEDQKEREEILKRYSPLRIFHNLKDVGFLQV    561 - 630
KVIRAEGLMAADVTGKSDPFCVVELNNDRLLTHTVYKNLNPEWNKVFTFNIKDIHSVLEVTVYDEDRDRS    631 - 700
ADFLGKVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIYLEIDVIFNAVKASLRTLIPKEQKYIEEENRLS    701 - 770
KQLLLRNFIRMKRCVMVLVNAAYYVNSCFDWDSPPRSLAAFVLFLFVVWNFELYMIPLVLLLLLTWNYFL    771 - 840
IISGKDNRQRDTVVEDMLEDEEEEDDKDDKDSEKKGFINKIYAIQEVCVSVQNILDEVASFGERIKNTFN    841 - 910
WTVPFLSWLAIVALCVFTAILYCIPLRYIVLVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQ    911 - 980
ELKPDPSHSPYKRKKNNLG                                                       981 - 999
//

Text Mined References (10)

PMID Year Title
26195140 2015 Multiple C2 domains transmembrane protein 1 is expressed in CNS neurons and possibly regulates cellular vesicle retrieval and oxidative stress.
23568457 2013 Genetic variants associated with disordered eating.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19416921 2009 Genome-wide association and meta-analysis of bipolar disorder in individuals of European ancestry.
15528213 2005 Evolutionarily conserved multiple C2 domain proteins with two transmembrane regions (MCTPs) and unusual Ca2+ binding properties.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.