Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.66
PubTator Score 4.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.300 3.3e-04
atypical teratoid / rhabdoid tumor 1.100 6.3e-03
Breast cancer -3.200 4.0e-02
chronic lymphosyte leukemia 1.300 5.7e-05
glioblastoma 1.100 7.8e-04
intraductal papillary-mucinous adenoma (... 2.000 2.9e-03
intraductal papillary-mucinous carcinoma... 1.400 5.5e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.4e-02
lung cancer -3.400 5.0e-05
lung carcinoma 1.400 5.7e-33
malignant mesothelioma -5.400 3.6e-09
medulloblastoma, large-cell 1.600 2.1e-05
osteosarcoma -1.656 4.0e-02
ovarian cancer -1.600 5.9e-09
psoriasis 1.400 8.0e-04
Rheumatoid arthritis 1.800 1.6e-02

Gene RIF (6)

AA Sequence

MDLDKPSVWGSLKQRTRPLLINLSKKKVKKNPSKPPDLRARHHLDRRLSLSVPDLLEAEALAPEGRPYSG      1 - 70
PQSSYTSVPSSLSTAGIFPKSSSSSLKQSEEELDWSQEEASHLHVVETDSEEAYASPAERRRVSSNGIFD     71 - 140
LQKTSLGGDAPEEPEKLCGSSDLNASMTSQHFEEQSVPGEASDGLSNLPSPFAYLLTIHLKEGRNLVVRD    141 - 210
RCGTSDPYVKFKLNGKTLYKSKVIYKNLNPVWDEIVVLPIQSLDQKLRVKVYDRDLTTSDFMGSAFVILS    211 - 280
DLELNRTTEHILKLEDPNSLEDDMGVIVLNLNLVVKQGDFKRHRWSNRKRLSASKSSLIRNLRLSESLKK    281 - 350
NQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQWQEQFDFHYFSDRMGILDIEV    351 - 420
WGKDNKKHEERLGTCKVDISALPLKQANCLELPLDSCLGALLMLVTLTPCAGVSVSDLCVCPLADLSERK    421 - 490
QITQRYCLQNSLKDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVF    491 - 560
TFPIKDIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIYNP    561 - 630
VKASIRTFTPREKRFVEDSRKLSKKILSRDVDRVKRITMAIWNTMQFLKSCFQWESTLRSTIAFAVFLIT    631 - 700
VWNFELYMIPLALLLIFVYNFIRPVKGKVSSIQDSQESTDIDDEEDEDDKESEKKGLIERIYMVQDIVST    701 - 770
VQNVLEEIASFGERIKNTFNWTVPFLSSLACLILAAATIILYFIPLRYIILIWGINKFTKKLRNPYSIDN    771 - 840
NELLDFLSRVPSDVQKVQYAELKLCSSHSPLRKKRSAL                                    841 - 878
//

Text Mined References (22)

PMID Year Title