Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.60
PubTator Score 10.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ovarian cancer 8520 5.2e-05
Multiple myeloma 1332 1.2e-03
Waldenstrons macroglobulinemia 765 1.2e-02
Disease Target Count Z-score Confidence
Leigh disease 100 0.0 5.0

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.620 1.2e-03
ovarian cancer -1.500 5.2e-05
Waldenstrons macroglobulinemia 1.051 1.2e-02

Gene RIF (7)

AA Sequence

MFRLLSWSLGRGFLRAAGRRCRGCSARLLPGLAGGPGPEVQVPPSRVAPHGRGPGLLPLLAALAWFSRPA      1 - 70
AAEEEEQQGADGAAAEDGADEAEAEIIQLLKRAKLSIMKDEPEEAELILHDALRLAYQTDNKKAITYTYD     71 - 140
LMANLAFIRGQLENAEQLFKATMSYLLGGGMKQEDNAIIEISLKLASIYAAQNRQEFAVAGYEFCISTLE    141 - 210
EKIEREKELAEDIMSVEEKANTHLLLGMCLDACARYLLFSKQPSQAQRMYEKALQISEEIQGERHPQTIV    211 - 280
LMSDLATTLDAQGRFDEAYIYMQRASDLARQINHPELHMVLSNLAAVLMHRERYTQAKEIYQEALKQAKL    281 - 350
KKDEISVQHIREELAELSKKSRPLTNSVKL                                            351 - 380
//

Text Mined References (18)

PMID Year Title