Property Summary

NCBI Gene PubMed Count 13
PubMed Score 345.38
PubTator Score 17.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 2.3e-03
Breast cancer -1.300 2.4e-04
colon cancer -1.400 1.3e-02
cystic fibrosis -1.706 1.8e-06
diabetes mellitus -1.100 1.6e-03
esophageal adenocarcinoma -1.100 3.3e-02
group 3 medulloblastoma 2.000 1.3e-05
intraductal papillary-mucinous adenoma (... -2.900 6.6e-06
intraductal papillary-mucinous carcinoma... -3.400 1.8e-03
intraductal papillary-mucinous neoplasm ... -2.300 8.1e-04
lung cancer -2.900 2.5e-04
lung carcinoma -1.400 8.7e-23
ovarian cancer 2.300 1.5e-04
spina bifida -1.695 3.6e-02

Gene RIF (3)

AA Sequence

MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGP      1 - 70
GAGAGAAAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRKLKLWNKYRISNIPSLIFLDA     71 - 140
TTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRS    141 - 210
LTRVLVESYRKIKEAGQNFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIM    211 - 280
LDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLIQP    281 - 350
IAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEA    351 - 420
FVNDFLAEKLKPEPI                                                           421 - 435
//

Text Mined References (18)

PMID Year Title