Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Synonym

Accession Q6DKI7 D6W5U9 Q9BVK3
Symbols CD112R
C7orf15

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
26755705 Describe CD112R, a member of poliovirus receptor-like proteins, as a new coinhibitory receptor for T cells. CD112R is preferentially expressed on T cells and inhibits T cell receptor-mediated signals.

AA Sequence

MRTEAQVPALQPPEPGLEGAMGHRTLVLPWVLLTLCVTAGTPEVWVQVRMEATELSSFTIRCGFLGSGSI      1 - 70
SLVTVSWGGPNGAGGTTLAVLHPERGIRQWAPARQARWETQSSISLILEGSGASSPCANTTFCCKFASFP     71 - 140
EGSWEACGSLPPSSDPGLSAPPTPAPILRADLAGILGVSGVLLFGCVYLLHLLRRHKHRPAPRLQPSRTS    141 - 210
PQAPRARAWAPSQASQAALHVPYATINTSCRPATLDTAHPHGGPSWWASLPTHAAHRPQGPAAWASTPIP    211 - 280
ARGSFVSVENGLYAQAGERPPHTGPGLTLFPDPRGPRAMEGPLGVR                            281 - 326
//

Text Mined References (6)

PMID Year Title
26755705 2016 Identification of CD112R as a novel checkpoint for human T cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16926269 2006 Comparative analysis of the paired immunoglobulin-like receptor (PILR) locus in six mammalian genomes: duplication, conversion, and the birth of new genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.