Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.67
PubTator Score 0.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 7.0e-96
Disease Target Count Z-score Confidence
Shwachman-Diamond syndrome 17 4.271 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.300 7.0e-96

Gene RIF (2)

AA Sequence

MAFSGCQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSCSGTRFAVDFQTGFSGNDIAFHFNPRFEDGG      1 - 70
YVVCNTRQKGTWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSV     71 - 140
QLSYISFQNPRAVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPSVRPANPAPITQTVIHTVQSASGQMFSQ    141 - 210
TPAIPPMMYPHPAYPMPFITTIPGGLYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVR    211 - 280
NTQINNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQ    281 - 350
LTHVQT                                                                    351 - 356
//

Text Mined References (11)

PMID Year Title