Property Summary

NCBI Gene PubMed Count 67
PubMed Score 109.14
PubTator Score 90.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -1.100 1.4e-04
ependymoma 1.100 2.3e-02
interstitial cystitis -1.300 2.1e-02
lung cancer 2.800 3.1e-05
lung carcinoma 1.300 3.0e-11
malignant mesothelioma -2.000 2.4e-07
medulloblastoma, large-cell -1.200 2.8e-04
ovarian cancer 1.700 3.0e-03
psoriasis -1.400 8.8e-04

 GO Component (2)

Gene RIF (50)

AA Sequence

MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCT      1 - 70
KAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKNYNTKLGFKRHL     71 - 140
ALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDRRFYTRKDVRRHMVVHTGR    141 - 210
KDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSK    211 - 280
PFTNTLQLNLYNTPFQSMQSSGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQ    281 - 350
PLKGEIESYLMELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLNTPALDFSQ    351 - 420
LFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSAAFTSSLSTST    421 - 490
TLPRFHQAFQ                                                                491 - 500
//

Text Mined References (72)

PMID Year Title