Property Summary

NCBI Gene PubMed Count 61
Grant Count 5
R01 Count 5
Funding $250,617.71
PubMed Score 100.04
PubTator Score 90.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
psoriasis -1.400 0.001
posterior fossa group B ependymoma 2.000 0.000
medulloblastoma, large-cell -1.200 0.000
lung cancer 2.800 0.000
interstitial cystitis -1.400 0.000
lung carcinoma 1.300 0.000
Breast cancer -1.100 0.000
ovarian cancer 1.700 0.003

Gene RIF (44)

PMID Text
26492619 The Thr34 of PLAG1 is critical for LpMab-10 recognition.
25786906 Data indicate that SLIT2, miR-218-1, RET/PLAG1 and SLIT2/ROBO1 pathway involved in Hirschsprung's disease.
25439740 Fluorescence in situ hybridization for PLAG1 or HMGA2 can be used to distinguish between pleomorphic adenoma and carcinoma ex-pleomorphic adenoma and their morphologic mimics.
25060425 The nuclear import of PLAG1 by KPNA2 is essential for the role of KPNA2 in HCC cells.
24700772 lipoblastoma is a group of lipomatous tumors with PLAG1 rearrangement and overexpression.
24516594 Altogether, these data suggest that HMGA2 is an upstream activator of PLAG1.
24468654 Lacrimal and salivary gland PAs and Ca-ex-PAs have similar genomic profiles and frequently overexpress the PLAG1 oncoprotein. Copy number gains involving 9p23-p22.3 (NFIB) and 22q12-qter (PDGFB) may be of importance for disease progression.
24433523 Report illustrates two different tumorigenic pathways implicating PLAG1 in lipoblastoma: amplification through multiple copies of a small marker chromosome derived from chromosome 8, and a paracentric inversion of the long arm of chromosome 8. Review.
24185117 Extraskeletal myxoid chondrosarcoma of the vulva with PLAG1 gene activation: molecular genetic characterization of 2 cases
23958548 a marker with good specificity for salivary gland pleomorphic adenomas
More...

AA Sequence

MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCT      1 - 70
KAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKNYNTKLGFKRHL     71 - 140
ALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDRRFYTRKDVRRHMVVHTGR    141 - 210
KDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSK    211 - 280
PFTNTLQLNLYNTPFQSMQSSGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQ    281 - 350
PLKGEIESYLMELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLNTPALDFSQ    351 - 420
LFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSAAFTSSLSTST    421 - 490
TLPRFHQAFQ                                                                491 - 500
//

Text Mined References (66)

PMID Year Title
26492619 2015 Development of Monoclonal Antibody LpMab-10 Recognizing Non-glycosylated PLAG1/2 Domain Including Thr34 of Human Podoplanin.
25786906 2015 SLIT2/ROBO1-miR-218-1-RET/PLAG1: a new disease pathway involved in Hirschsprung's disease.
25439740 2015 Consistent PLAG1 and HMGA2 abnormalities distinguish carcinoma ex-pleomorphic adenoma from its de novo counterparts.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25060425 2014 Pleomorphic adenoma gene 1 mediates the role of karyopherin alpha 2 and has prognostic significance in hepatocellular carcinoma.
24700772 2014 Identification of COL3A1 and RAB2A as novel translocation partner genes of PLAG1 in lipoblastoma.
24516594 2014 Correlated expression of HMGA2 and PLAG1 in thyroid tumors, uterine leiomyomas and experimental models.
24468654 2014 Lacrimal gland pleomorphic adenoma and carcinoma ex pleomorphic adenoma: genomic profiles, gene fusions, and clinical characteristics.
24433523 2014 Diagnostic utility of molecular and cytogenetic analysis in lipoblastoma: a study of two cases and review of the literature.
24185117 2014 Extraskeletal myxoid chondrosarcoma of the vulva with PLAG1 gene activation: molecular genetic characterization of 2 cases.
More...