Property Summary

NCBI Gene PubMed Count 4
Grant Count 4
Funding $555,355.79
PubMed Score 20.38
PubTator Score 6.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.100 0.001
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.300 0.001

Gene RIF (2)

PMID Text
23645737 Mutations in adenosine deaminase-like (ADAL) protein confer drug resistance in Uterine Cervical Neoplasms.
21755941 Data indicated that ADAL1 specifically acts at the 6-position of purine and 2-aminopurine nucleoside monophosphates.

AA Sequence

MIEAEEQQPCKTDFYSELPKVELHAHLNGSISSHTMKKLIAQKPDLKIHDQMTVIDKGKKRTLEECFQMF      1 - 70
QTIHQLTSSPEDILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESILEGIKQSKQENLDID     71 - 140
VRYLIAVDRRGGPLVAKETVKLAEEFFLSTEGTVLGLDLSGDPTVGQAKDFLEPLLEAKKAGLKLALHLS    141 - 210
EIPNQKKETQILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLELCLTSNVKSQTVPSYDQHHFGF    211 - 280
WYSIAHPSVICTDDKGVFATHLSQEYQLAAETFNLTQSQVWDLSYESINYIFASDSTRSELRKKWNHLKP    281 - 350
RVLHI                                                                     351 - 355
//

Text Mined References (7)

PMID Year Title
23645737 2013 Mutations in adenosine deaminase-like (ADAL) protein confer resistance to the antiproliferative agents N6-cyclopropyl-PMEDAP and GS-9219.
21755941 2011 Adenosine deaminase-like protein 1 (ADAL1): characterization and substrate specificity in the hydrolysis of N(6)- or O(6)-substituted purine or 2-aminopurine nucleoside monophosphates.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16245011 2005 Phylogenetic analysis reveals a novel protein family closely related to adenosine deaminase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.