Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.59
PubTator Score 6.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.200 4.5e-04
Astrocytoma, Pilocytic 1.300 8.7e-07
atypical teratoid / rhabdoid tumor 1.600 1.6e-05
Breast cancer 2.700 2.7e-02
Duchenne muscular dystrophy 1.034 1.7e-06
ependymoma 1.100 5.7e-11
glioblastoma 1.500 2.7e-06
intraductal papillary-mucinous carcinoma... 1.600 2.3e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.7e-02
lung adenocarcinoma 1.400 1.2e-08
medulloblastoma 1.100 5.1e-05
medulloblastoma, large-cell 1.200 6.6e-03
non-small cell lung cancer 1.251 4.0e-14
osteosarcoma 1.185 1.1e-04
ovarian cancer -2.100 3.4e-08

Gene RIF (3)

AA Sequence

MLSPQRVAAAASRGADDAMESSKPGPVQVVLVQKDQHSFELDEKALASILLQDHIRDLDVVVVSVAGAFR      1 - 70
KGKSFILDFMLRYLYSQKESGHSNWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVEKPGGKKVAVVL     71 - 140
MDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEIFQKPFQTLMF    141 - 210
LVRDWSFPYEYSYGLQGGMAFLDKRLQVKEHQHEEIQNVRNHIHSCFSDVTCFLLPHPGLQVATSPDFDG    211 - 280
KLKDIAGEFKEQLQALIPYVLNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAEA    281 - 350
NNLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQELEEE    351 - 420
IKELYENFCKHNGSKNVFSTFRTPAVLFTGIVALYIASGLTGFIGLEVVAQLFNCMVGLLLIALLTWGYI    421 - 490
RYSGQYRELGGAIDFGAAYVLEQASSHIGNSTQATVRDAVVGRPSMDKKAQ                       491 - 541
//

Text Mined References (20)

PMID Year Title