Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $26,189.34
PubMed Score 6.56
PubTator Score 6.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6DD88 Q8N7W5 Q9H8Q5 Q9UFL1
Symbols HSN1F

Gene

 Grant Application (2)

Gene RIF (3)

PMID Text
25773277 These results suggest that the three ATLs have different capacities to mediate endoplasmic reticulum fusion, with ATL1 being the strongest and ATL3 being the weakest.
24459106 ATL3 is implicated in the structural organization of intracellular organelles, which may be critical to axonal survival.
18270207 A family of human GTPases, atlastin-2 and -3 that are closely related to atlastin-1 are described.

AA Sequence

MLSPQRVAAAASRGADDAMESSKPGPVQVVLVQKDQHSFELDEKALASILLQDHIRDLDVVVVSVAGAFR      1 - 70
KGKSFILDFMLRYLYSQKESGHSNWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVEKPGGKKVAVVL     71 - 140
MDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEIFQKPFQTLMF    141 - 210
LVRDWSFPYEYSYGLQGGMAFLDKRLQVKEHQHEEIQNVRNHIHSCFSDVTCFLLPHPGLQVATSPDFDG    211 - 280
KLKDIAGEFKEQLQALIPYVLNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAEA    281 - 350
NNLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQELEEE    351 - 420
IKELYENFCKHNGSKNVFSTFRTPAVLFTGIVALYIASGLTGFIGLEVVAQLFNCMVGLLLIALLTWGYI    421 - 490
RYSGQYRELGGAIDFGAAYVLEQASSHIGNSTQATVRDAVVGRPSMDKKAQ                       491 - 541
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25773277 2015 Human atlastin GTPases mediate differentiated fusion of endoplasmic reticulum membranes.
24459106 2014 Sensory neuropathy with bone destruction due to a mutation in the membrane-shaping atlastin GTPase 3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23969831 2013 Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19665976 2009 A class of dynamin-like GTPases involved in the generation of the tubular ER network.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...