Property Summary

NCBI Gene PubMed Count 1
PubMed Score 9.34
PubTator Score 6.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.9e-10
osteosarcoma 7950 6.2e-07
medulloblastoma, large-cell 6241 7.6e-04
Disease Target Count Z-score Confidence
Spinal stenosis 19 4.441 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 7.6e-04
osteosarcoma -1.271 6.2e-07
ovarian cancer 1.500 1.9e-10

AA Sequence

MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLSPPQSAPPAGPPPRPRPPAPYICNE      1 - 70
CGKSFSHWSKLTRHQRTHTGERPNACADCGKTFSQSSHLVQHRRIHTGEKPYACLECGKRFSWSSNLMQH     71 - 140
QRIHTGEKPYTCPDCGRSFTQSKSLAKHRRSHSGLKPFVCPRCGRGFSQPKSLARHLRLHPELSGPGVAA    141 - 210
KVLAASVRRAKGPEEAVAADGEIAIPVGDGEGIIVVGAPGEGAAAAAAMAGAGAKAAGPRSRRAPAPKPY    211 - 280
VCLECGKGFGHGAGLLAHQRAQHGDGLGAAGGEEPAHICVECGEGFVQGAALRRHKKIHAVGAPSVCSSC    281 - 350
GQSYYRAGGEEEDDDDDEAAGGRCPECRGGEGR                                         351 - 383
//

Text Mined References (8)

PMID Year Title