Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.2309972313105E-15
ovarian cancer 8492 0.0140477852634363
group 3 medulloblastoma 2254 0.0142020596871602

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.199 0.000
group 3 medulloblastoma 1.200 0.014
ovarian cancer 1.600 0.014

Synonym

Accession Q6DCA0 B4E276
Symbols

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

AA Sequence

MGKRRCVPPLEPKLAAGCCGVKKPKLSGSGTHSHGNQSTTVPGSSSGPLQNHQHVDSSSGRENVSDLTLG      1 - 70
PGNSPITRMNPASGALSPLPRPNGTANTTKNLVVTAEMCCYCFDVLYCHLYGFPQPRLPRFTNDPYPLFV     71 - 140
TWKTGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRFPPLTREELPKLFCSVSLLTNFEDASDYLDW    141 - 210
EVGVHGIRIEFINEKGVKRTATYLPEVAKEQDWDQIQTIDSLLRKGGFKAPITSEFRKTIKLTRYRSEKV    211 - 280
TISYAEYIASRQHCFQNGTLHAPPLYNHYS                                            281 - 310
//

Text Mined References (7)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.