Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 1.2e-15
ovarian cancer 8520 5.0e-04
group 3 medulloblastoma 4104 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 1.4e-02
juvenile dermatomyositis 1.199 1.2e-15
ovarian cancer -1.300 5.0e-04

AA Sequence

MGKRRCVPPLEPKLAAGCCGVKKPKLSGSGTHSHGNQSTTVPGSSSGPLQNHQHVDSSSGRENVSDLTLG      1 - 70
PGNSPITRMNPASGALSPLPRPNGTANTTKNLVVTAEMCCYCFDVLYCHLYGFPQPRLPRFTNDPYPLFV     71 - 140
TWKTGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRFPPLTREELPKLFCSVSLLTNFEDASDYLDW    141 - 210
EVGVHGIRIEFINEKGVKRTATYLPEVAKEQDWDQIQTIDSLLRKGGFKAPITSEFRKTIKLTRYRSEKV    211 - 280
TISYAEYIASRQHCFQNGTLHAPPLYNHYS                                            281 - 310
//

Text Mined References (7)

PMID Year Title