Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.71
PubTator Score 1.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6BDI9 B2RU16
Symbols RAB15EP

Gene

AA Sequence

MGQKASQQLALKDSKEVPVVCEVVSEAIVHAAQKLKEYLGFEYPPSKLCPAANTLNEIFLIHFITFCQEK      1 - 70
GVDEWLTTTKMTKHQAFLFGADWIWTFWGSNKQIKLQLAVQTLQMSSPPPVESKPCDLSNPESRVEESSW     71 - 140
KKSRFDKLEEFCNLIGEDCLGLFIIFGMPGKPKDIRGVVLDSVKSQMVRSHLPGGKAVAQFVLETEDCVF    141 - 210
IKELLRNCLSKKDGLREVGKVYISIL                                                211 - 236
//

Text Mined References (5)

PMID Year Title
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
16541075 2006 The finished DNA sequence of human chromosome 12.
16195351 2005 Rab15 effector protein: a novel protein for receptor recycling from the endocytic recycling compartment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.