Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.71
PubTator Score 1.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6BDI9 B2RU16
Symbols RAB15EP

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MGQKASQQLALKDSKEVPVVCEVVSEAIVHAAQKLKEYLGFEYPPSKLCPAANTLNEIFLIHFITFCQEK      1 - 70
GVDEWLTTTKMTKHQAFLFGADWIWTFWGSNKQIKLQLAVQTLQMSSPPPVESKPCDLSNPESRVEESSW     71 - 140
KKSRFDKLEEFCNLIGEDCLGLFIIFGMPGKPKDIRGVVLDSVKSQMVRSHLPGGKAVAQFVLETEDCVF    141 - 210
IKELLRNCLSKKDGLREVGKVYISIL                                                211 - 236
//

Text Mined References (5)

PMID Year Title
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
16541075 2006 The finished DNA sequence of human chromosome 12.
16195351 2005 Rab15 effector protein: a novel protein for receptor recycling from the endocytic recycling compartment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.