Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.49
PubTator Score 1.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease 1.116 1.2e-02
astrocytic glioma -2.000 2.5e-02
ependymoma -2.300 3.1e-02
glioblastoma 1.300 3.7e-02
group 3 medulloblastoma -1.300 4.8e-02
interstitial cystitis -1.500 6.8e-05
lung carcinoma -1.600 2.1e-24
non primary Sjogren syndrome sicca 1.100 1.9e-02
non-small cell lung cancer 1.324 5.1e-07
oligodendroglioma -1.800 4.5e-02
Pick disease -1.500 1.8e-03
progressive supranuclear palsy -1.300 2.0e-02

Gene RIF (4)

AA Sequence

MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYT      1 - 70
PVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTS     71 - 140
EPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQTEEDILVRKELEEIARTHPDQFNL    141 - 210
WYTLDRPPIGWKYSSGFVTADMIKEHLPPPAKSTLILVCGPPPLIQTAAHPNLEKLGYTQDMIFTY        211 - 276
//

Text Mined References (15)

PMID Year Title