Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.51
PubTator Score 1.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.000 0.025
ependymoma -2.300 0.031
oligodendroglioma -1.800 0.045
group 4 medulloblastoma -1.500 0.003
glioblastoma 1.300 0.037
non-small cell lung cancer 1.324 0.000
active Crohn's disease 1.116 0.012
interstitial cystitis -1.500 0.000
non primary Sjogren syndrome sicca 1.100 0.019
lung carcinoma -1.600 0.000
Pick disease -1.500 0.002
progressive supranuclear palsy -1.300 0.020

Synonym

Accession Q6BCY4 Q9BVA3 Q9UF68 Q9UHJ0 b5R.2
Symbols B5R.2

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
26323991 Study showed that multifocal or multicentric glioblastomas have some underlying genetic and epigenetic characteristics that are associated with poor prognosis and that CYB5R2 is a new epigenetic marker for glioblastoma prognosis
24338690 findings suggest that CYB5R2 may be a functional tumor suppressor gene, frequently inactivated by hypermethylation of its promoter in nasopharyngeal carcinoma
20877624 Observational study of gene-disease association. (HuGE Navigator)
15858218 CYB5R2 is a key enzyme involved in the mediation of NADH-induced redox activity in human spermatozoa.

AA Sequence

MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYT      1 - 70
PVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTS     71 - 140
EPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQTEEDILVRKELEEIARTHPDQFNL    141 - 210
WYTLDRPPIGWKYSSGFVTADMIKEHLPPPAKSTLILVCGPPPLIQTAAHPNLEKLGYTQDMIFTY        211 - 276
//

Text Mined References (15)

PMID Year Title
26323991 2015 Genetic, epigenetic, and molecular landscapes of multifocal and multicentric glioblastoma.
25416956 2014 A proteome-scale map of the human interactome network.
24338690 2014 Cytochrome b5 reductase 2 is a novel candidate tumor suppressor gene frequently inactivated by promoter hypermethylation in human nasopharyngeal carcinoma.
23972371 2013 Genome-wide association analysis of blood-pressure traits in African-ancestry individuals reveals common associated genes in African and non-African populations.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15858218 2005 Identification of cytochrome-b5 reductase as the enzyme responsible for NADH-dependent lucigenin chemiluminescence in human spermatozoa.
More...