Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.84
PubTator Score 17.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 3 medulloblastoma 2254 9.81233974241309E-6
ependymoma 2514 0.00321180714655975
astrocytic glioma 2241 0.0122402714747221
oligodendroglioma 2849 0.0137159813797294

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.400 0.012
ependymoma -1.400 0.003
oligodendroglioma -1.100 0.014
group 3 medulloblastoma -1.800 0.000

Synonym

Accession Q6BAA4 A2A3J5 A2A3J7 Q5VXA6 Q6BAA0 Q6BAA1 Q6BAA2 Q6BAA3 Q8IXZ7
Symbols FcRY
FCRL2
FCRLY
FCRLM2
FREB-2

Gene

PANTHER Protein Class (1)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
23593433 The aim of the study was to associate multiple polymorphisms within FCGR gene locus with IgA nephropathy in a large Chinese cohort.
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
16263223 Fcry is upregulated by short-term treatment with BAFF/BLyS, which promotes B cell survival rather than proliferation
15676285 Expression analysis revealed FCRL2 mRNA only in placenta.FCRL2 is differentially expressed by transformed B cell lines.

AA Sequence

MWPLTALLLLVPSSGQAATLEKPILSLHPPWTTIFKGERVTLKCDGYHPLLLELQPISTLWYLGHLLLPS      1 - 70
HKKSIEVQTPGVYRCQTRGAPVSDPIHLSVSNDWLILQVPYAPVFEGEPLVLRCRGWYDKVVYKLHYYHD     71 - 140
GQAVRYFHSSANYTVLQARASDSGRYQCSGTMRIPVESAPMFSAKVAVTVQELFRAPVLRVMGPREARGA    141 - 210
ALGGVVLRCDTRLHPQKRDTPLQFAFYKYSRAVRRFDWGAEYTVPEPEVEELESYWCEAATATRSVRKRS    211 - 280
PWLQLPGPGSPLDPASTTAPAPWAAALAPGNRPLSFRKPPVSRSVPLVTSVRNTTSTGLQFPASGAPTAG    281 - 350
PPACAPPTPLEQSAGALKPDVDLLLREMQLLKGLLSRVVLELKEPQALRELRGTPETPTSHFAVSPGTPE    351 - 420
TTPVES                                                                    421 - 426
//

Text Mined References (12)

PMID Year Title
23593433 2013 FCGR2B and FCRLB gene polymorphisms associated with IgA nephropathy.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17273841 2007 The first avian Ig-like Fc receptor family member combines features of mammalian FcR and FCRL.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16263223 2005 FcRY, an Fc receptor related gene differentially expressed during B lymphocyte development and activation.
15815692 2005 A new Fc receptor homolog, FREB2, found in germinal center B cells.
15676285 2005 Cloning and characterization of the human FCRL2 gene.
15551350 2005 Novel melanoma antigen, FCRL/FREB, identified by cDNA profile comparison using DNA chip are immunogenic in multiple melanoma patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...