Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.67
PubTator Score 17.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 9.8e-06
ependymoma 4679 3.2e-03
astrocytic glioma 2597 1.2e-02
oligodendroglioma 2850 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.400 1.2e-02
ependymoma -1.400 3.2e-03
group 3 medulloblastoma -1.800 9.8e-06
oligodendroglioma -1.100 1.4e-02

Gene RIF (5)

AA Sequence

MWPLTALLLLVPSSGQAATLEKPILSLHPPWTTIFKGERVTLKCDGYHPLLLELQPISTLWYLGHLLLPS      1 - 70
HKKSIEVQTPGVYRCQTRGAPVSDPIHLSVSNDWLILQVPYAPVFEGEPLVLRCRGWYDKVVYKLHYYHD     71 - 140
GQAVRYFHSSANYTVLQARASDSGRYQCSGTMRIPVESAPMFSAKVAVTVQELFRAPVLRVMGPREARGA    141 - 210
ALGGVVLRCDTRLHPQKRDTPLQFAFYKYSRAVRRFDWGAEYTVPEPEVEELESYWCEAATATRSVRKRS    211 - 280
PWLQLPGPGSPLDPASTTAPAPWAAALAPGNRPLSFRKPPVSRSVPLVTSVRNTTSTGLQFPASGAPTAG    281 - 350
PPACAPPTPLEQSAGALKPDVDLLLREMQLLKGLLSRVVLELKEPQALRELRGTPETPTSHFAVSPGTPE    351 - 420
TTPVES                                                                    421 - 426
//

Text Mined References (12)

PMID Year Title