Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.50
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 3.8e-29

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.200 3.8e-29

AA Sequence

MVPRISAAIFIFELLGSNSEGVTDLRLWLCQPAPRCGEWTYNPLEQCCDDGVILDLNQTRLCGSSCTFWP      1 - 70
CFQHCCLESLGSQNQTVVRFKVPGMKPDCKSSPITRICAQEYHPKSPVSRSDLI                     71 - 124
//

Text Mined References (3)

PMID Year Title