Property Summary

NCBI Gene PubMed Count 8
PubMed Score 131.05
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.1e-05
tuberculosis 2010 1.7e-02
mucosa-associated lymphoid tissue lymphoma 484 2.1e-02
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0

Expression

  Differential Expression (3)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 2.323 2.1e-02
osteosarcoma -5.459 2.1e-05
tuberculosis 1.700 1.7e-02

Gene RIF (2)

AA Sequence

MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQRMLAAVGAAV      1 - 70
QHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVLTEKY     71 - 140
R//

Text Mined References (10)

PMID Year Title