Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.67
PubTator Score 5.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
psoriasis -1.800 0.000
osteosarcoma -2.202 0.000
medulloblastoma, large-cell -1.400 0.000
lung carcinoma 1.400 0.000
ovarian cancer -2.400 0.000

Synonym

Accession Q6AZZ1 A6NI19 A8K551 B3KPM5 B4DVK4 Q8WZ70 Q96LE5 Q96PF7 Q9H9C2 Q9NW18
Symbols SS56
GC109
SS-56
RNF137

Gene

Gene RIF (3)

PMID Text
24999993 TRIM68 targets TFG, a novel regulator of IFN production, and in doing so turns off and limits type I IFN production in response to anti-viral detection systems
19795399 Observational study of gene-disease association. (HuGE Navigator)
18451177 TRIM68 functions as a cofactor for AR-mediated transcription and is likely to be a novel diagnostic tool and a potentially therapeutic target for prostate cancer.

AA Sequence

MDPTALVEAIVEEVACPICMTFLREPMSIDCGHSFCHSCLSGLWEIPGESQNWGYTCPLCRAPVQPRNLR      1 - 70
PNWQLANVVEKVRLLRLHPGMGLKGDLCERHGEKLKMFCKEDVLIMCEACSQSPEHEAHSVVPMEDVAWE     71 - 140
YKWELHEALEHLKKEQEEAWKLEVGERKRTATWKIQVETRKQSIVWEFEKYQRLLEKKQPPHRQLGAEVA    141 - 210
AALASLQREAAETMQKLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEP    211 - 280
ISLELKTDCRVLGLREILKTYAADVRLDPDTAYSRLIVSEDRKRVHYGDTNQKLPDNPERFYRYNIVLGS    281 - 350
QCISSGRHYWEVEVGDRSEWGLGVCKQNVDRKEVVYLSPHYGFWVIRLRKGNEYRAGTDEYPILSLPVPP    351 - 420
RRVGIFVDYEAHDISFYNVTDCGSHIFTFPRYPFPGRLLPYFSPCYSIGTNNTAPLAICSLDGED         421 - 485
//

Text Mined References (18)

PMID Year Title
24999993 2014 TRIM68 negatively regulates IFN-? production by degrading TRK fused gene, a novel driver of IFN-? downstream of anti-viral detection systems.
22805767 2012 Epigenetic deregulation of miR-29a and miR-1256 by isoflavone contributes to the inhibition of prostate cancer cell growth and invasion.
21979307 2011 TRIM proteins and cancer.
19795399 2009 Genome-wide linkage scans for type 2 diabetes mellitus in four ethnically diverse populations-significant evidence for linkage on chromosome 4q in African Americans: the Family Investigation of Nephropathy and Diabetes Research Group.
19212346 2009 Melanoma inhibitor of apoptosis protein (ML-IAP) specific cytotoxic T lymphocytes cross-react with an epitope from the auto-antigen SS56.
18451177 2008 TRIM68 regulates ligand-dependent transcription of androgen receptor in prostate cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...