Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.50
PubTator Score 5.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 1.3e-24
ovarian cancer 8520 1.7e-14
osteosarcoma 7950 1.5e-06
malignant mesothelioma 3232 4.2e-06
psoriasis 6694 3.5e-05
medulloblastoma, large-cell 6241 7.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Spinal stenosis 19 3.249 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
lung carcinoma 1.400 1.3e-24
malignant mesothelioma -1.100 4.2e-06
medulloblastoma, large-cell -1.400 7.7e-05
osteosarcoma -2.202 1.5e-06
ovarian cancer -2.400 1.7e-14
psoriasis -1.800 3.5e-05

Gene RIF (3)

AA Sequence

MDPTALVEAIVEEVACPICMTFLREPMSIDCGHSFCHSCLSGLWEIPGESQNWGYTCPLCRAPVQPRNLR      1 - 70
PNWQLANVVEKVRLLRLHPGMGLKGDLCERHGEKLKMFCKEDVLIMCEACSQSPEHEAHSVVPMEDVAWE     71 - 140
YKWELHEALEHLKKEQEEAWKLEVGERKRTATWKIQVETRKQSIVWEFEKYQRLLEKKQPPHRQLGAEVA    141 - 210
AALASLQREAAETMQKLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEP    211 - 280
ISLELKTDCRVLGLREILKTYAADVRLDPDTAYSRLIVSEDRKRVHYGDTNQKLPDNPERFYRYNIVLGS    281 - 350
QCISSGRHYWEVEVGDRSEWGLGVCKQNVDRKEVVYLSPHYGFWVIRLRKGNEYRAGTDEYPILSLPVPP    351 - 420
RRVGIFVDYEAHDISFYNVTDCGSHIFTFPRYPFPGRLLPYFSPCYSIGTNNTAPLAICSLDGED         421 - 485
//

Text Mined References (18)

PMID Year Title