Property Summary

NCBI Gene PubMed Count 17
PubMed Score 104.78
PubTator Score 433.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 1.200 5.1e-03
atypical teratoid / rhabdoid tumor -1.300 4.1e-05
Breast cancer -1.100 2.5e-04
chronic rhinosinusitis -1.035 1.5e-02
ependymoma 2.300 1.3e-02
glioblastoma multiforme 1.200 4.3e-16
group 4 medulloblastoma -1.600 2.4e-04
Hydrolethalus syndrome -1.782 2.9e-02
intraductal papillary-mucinous carcinoma... -1.300 7.2e-04
intraductal papillary-mucinous neoplasm ... -1.200 9.9e-03
medulloblastoma, large-cell -1.200 1.7e-03
Multiple Sclerosis 2.700 2.2e-04
oligodendroglioma 1.400 1.0e-02
osteosarcoma 1.313 2.0e-02
ovarian cancer 1.400 3.6e-02
subependymal giant cell astrocytoma 1.737 3.4e-02

 GO Function (1)

Gene RIF (11)

AA Sequence

MKVRSAGGDGDALCVTEEDLAGDDEDMPTFPCTQKGRPGPRCSRCQKNLSLHTSVRILYLFLALLLVAVA      1 - 70
VLASLVFRKVDSLSEDISLTQSIYDKKLVLMQKNLQGLDPKALNNCSFCHEAGQLGPEIRKLQEELEGIQ     71 - 140
KLLLAQEVQLDQTLQAQEVLSTTSRQISQEMGSCSFSIHQVNQSLGLFLAQVRGWQATTAGLDLSLKDLT    141 - 210
QECYDVKAAVHQINFTVGQTSEWIHGIQRKTDEETLTLQKIVTDWQNYTRLFSGLRTTSTKTGEAVKNIQ    211 - 280
ATLGASSQRISQNSESMHDLVLQVMGLQLQLDNISSFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRM    281 - 350
ASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRERFSLL    351 - 420
SARLDLNVRNLSMIVEEMKAVDTQHGEILRNVTILRGAPGPPGPRGFKGDMGVKGPVGGRGPKGDPGSLG    421 - 490
PLGPQGPQGQPGEAGPVGERGPVGPRGFPGLKGSKGSFGTGGPRGQPGPKGDIGPPGPEGPPGSPGPSGP    491 - 560
QGKPGIAGKTGSPGQRGAMGPKGEPGIQGPPGLPGPPGPPGSQSFY                            561 - 606
//

Text Mined References (17)

PMID Year Title