Property Summary

NCBI Gene PubMed Count 16
Grant Count 49
R01 Count 41
Funding $6,221,456.25
PubMed Score 92.56
PubTator Score 433.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25956032 Suppression of CSR1 expression is a novel mechanism critical for the oncogenic activity of miR-650.
24491563 Findings regarding the interaction of NADPH-P450 reductase (NPR) with cellular stress response (CSR) indicated function of NPR in hypoxic response.
23728617 Treatment of human primary astrocytes with HIV-1 Vpr downregulates expression of eleven genes, BNIP3, CYGB, DUOX2, DUSP1, FOXM1, GAPDH, HPRT1, MT3, MTL5, PTGS2, and SCARA3
23537707 Data indicate that the clinical samples showed an inverse correlation between SCARA3 gene expression, myeloma progression, and favorable clinical prognosis.
22683311 The binding of CSR1 with XIAP enhanced caspase-9 and caspase-3 protease activities.
22138034 Results demonstrate the involvement of SCARA3 and SCARA5 in the uptake of PF14-oligonucleotide nanocomplexes.
21855113 The consistently high SCARA3 levels in both primary carcinomas and metastatic cells in effusions, and its up-regulation along disease progression from diagnosis to recurrence, suggest a role in ovarian cancer biology.
20485444 Observational study of gene-disease association. (HuGE Navigator)
18806823 CSR1 appears to induce cell death through a novel mechanism by hijacking a critical RNA processing enzyme CPSF3.
16436673 Down-regulation of CSR1 protein expression by promoter methylation is associated with tumor growth and metastasis of prostate cancer

AA Sequence

MKVRSAGGDGDALCVTEEDLAGDDEDMPTFPCTQKGRPGPRCSRCQKNLSLHTSVRILYLFLALLLVAVA      1 - 70
VLASLVFRKVDSLSEDISLTQSIYDKKLVLMQKNLQGLDPKALNNCSFCHEAGQLGPEIRKLQEELEGIQ     71 - 140
KLLLAQEVQLDQTLQAQEVLSTTSRQISQEMGSCSFSIHQVNQSLGLFLAQVRGWQATTAGLDLSLKDLT    141 - 210
QECYDVKAAVHQINFTVGQTSEWIHGIQRKTDEETLTLQKIVTDWQNYTRLFSGLRTTSTKTGEAVKNIQ    211 - 280
ATLGASSQRISQNSESMHDLVLQVMGLQLQLDNISSFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRM    281 - 350
ASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRERFSLL    351 - 420
SARLDLNVRNLSMIVEEMKAVDTQHGEILRNVTILRGAPGPPGPRGFKGDMGVKGPVGGRGPKGDPGSLG    421 - 490
PLGPQGPQGQPGEAGPVGERGPVGPRGFPGLKGSKGSFGTGGPRGQPGPKGDIGPPGPEGPPGSPGPSGP    491 - 560
QGKPGIAGKTGSPGQRGAMGPKGEPGIQGPPGLPGPPGPPGSQSFY                            561 - 606
//

Text Mined References (16)

PMID Year Title
25956032 2015 Oncogenic Activity of miR-650 in Prostate Cancer Is Mediated by Suppression of CSR1 Expression.
25416956 2014 A proteome-scale map of the human interactome network.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
24491563 2014 A cellular stress response (CSR) that interacts with NADPH-P450 reductase (NPR) is a new regulator of hypoxic response.
23537707 2013 Scavenger receptor class A member 3 (SCARA3) in disease progression and therapy resistance in multiple myeloma.
22683311 2012 Interaction of CSR1 with XIAP reverses inhibition of caspases and accelerates cell death.
22138034 2012 Scavenger receptor-mediated uptake of cell-penetrating peptide nanocomplexes with oligonucleotides.
21855113 2012 SCARA3 mRNA is overexpressed in ovarian carcinoma compared with breast carcinoma effusions.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
18806823 2009 CSR1 induces cell death through inactivation of CPSF3.
More...