Property Summary

NCBI Gene PubMed Count 9
PubMed Score 64.91
PubTator Score 33.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 9.1e-07
group 3 medulloblastoma -1.100 2.1e-03
intraductal papillary-mucinous carcinoma... -1.400 2.0e-02
lung adenocarcinoma -1.400 3.1e-17
lung cancer -2.500 3.2e-04
lung carcinoma -1.900 4.9e-23
non-small cell lung cancer -1.720 4.9e-23
osteosarcoma 2.608 9.5e-07
ovarian cancer -2.000 1.7e-11
Pick disease 1.300 1.6e-06
pituitary cancer -1.100 1.8e-04

Gene RIF (2)

AA Sequence

MPRRAGSGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDPRDRLTKPLSFADCVGDELPWGWEAGFDPQ      1 - 70
IGVYYIDHINKTTQIEDPRKQWRGEQEKMLKDYLSVAQDALRTQKELYHVKEQRLALALDEYVRLNDAYK     71 - 140
EKSSSHTSLFSGSSSSTKYDPDILKAEISTTRLRVKKLKRELSQMKQELLYKEQGFETLQQIDKKMSGGQ    141 - 210
SGYELSEAKAILTELKSIRKAISSGEKEKQDLMQSLAKLQERFHLDQNIGRSEPDLRCSPVNSHLCLSRQ    211 - 280
TLDAGSQTSISGDIGVRSRSNLAEKVRLSLQYEEAKRSMANLKIELSKLDSEAWPGALDIEKEKLMLINE    281 - 350
KEELLKELQFVTPQKRTQDELERLEAERQRLEEELLSVRGTPSRALAERLRLEERRKELLQKLEETTKLT    351 - 420
TYLHSQLKSLSASTLSMSSGSSLGSLASSRGSLNTSSRGSLNSLSSTELYYSSQSDQIDVDYQYKLDFLL    421 - 490
QEKSGYIPSGPITTIHENEVVKSPSQPGQSGLCGVAAAATGHTPPLAEAPKSVASLSSRSSLSSLSPPGS    491 - 560
PLVLEGTFPMSSSHDASLHQFTADFEDCELSSHFADISLIENQILLDSDSGGASQSLSEDKDLNECAREP    561 - 630
LYEGTADVEKSLPKRRVIHLLGEKTTCVSAAVSDESVAGDSGVYEAFVKQPSEMEDVTYSEEDVAIVETA    631 - 700
QVQIGLRYNAKSSSFMVIIAQLRNLHAFLIPHTSKVYFRVAVLPSSTDVSCLFRTKVHPPTESILFNDVF    701 - 770
RVAISQTALQQKTLRVDLCSVSKHRREECLAGTQISLADLPFSSEVFTLWYNLLPSKQMPCKKNEENEDS    771 - 840
VFQPNQPLVDSIDLDAVSALLARTSAELLAVEQELAQEEEEESGQEEPRGPDGDWLTMLREASDEIVAEK    841 - 910
EAEVKLPEDSSCTEDLSSCTSVPEMNEDGNRKESNCAKDLRSQPPTRIPTLVDKETNTDEAANDNMAVRP    911 - 980
KERSSLSSRQHPFVRSSVIVRSQTFSPGERNQYICRLNRSDSDSSTLAKKSLFVRNSTERRSLRVKRTVC    981 - 1050
QSVLRRTTQECPVRTSLDLELDLQASLTRQSRLNDELQALRDLRQKLEELKAQGETDLPPGVLEDERFQR   1051 - 1120
LLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDVCRLREQSQKVPRQVQSFREKIAYFTRAKISIPSLPAD   1121 - 1190
DV                                                                       1191 - 1192
//

Text Mined References (14)

PMID Year Title