Property Summary

NCBI Gene PubMed Count 8
Grant Count 29
R01 Count 8
Funding $2,117,053.59
PubMed Score 17.37
PubTator Score 8.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

Gene RIF (3)

PMID Text
24874739 EIPA, a potent and specific inhibitor of Na+/H+ exchanger activity, significantly inhibits the Nef internalization into M2-macrophages, indicating that Nef is imported by Na+/H+ exchanger (solute carrier family 9, subfamily A)
22049213 Data demonstrate functional NHE4 activity in the rat and human colon and suggest that this exchanger is capable of modulating intracellular pH over a wide pH spectrum and may play an important role in maintaining cellular pH homeostasis.
17943310 T84 human colon cells contain three isoforms of the Na+/H+ exchanger, NHE1, NHE2, and NHE4, but not the Cl-dependent NHE

AA Sequence

MALQMFVTYSPWNCLLLLVALECSEASSDLNESANSTAQYASNAWFAAASSEPEEGISVFELDYDYVQIP      1 - 70
YEVTLWILLASLAKIGFHLYHRLPGLMPESCLLILVGALVGGIIFGTDHKSPPVMDSSIYFLYLLPPIVL     71 - 140
EGGYFMPTRPFFENIGSILWWAVLGALINALGIGLSLYLICQVKAFGLGDVNLLQNLLFGSLISAVDPVA    141 - 210
VLAVFEEARVNEQLYMMIFGEALLNDGITVVLYNMLIAFTKMHKFEDIETVDILAGCARFIVVGLGGVLF    211 - 280
GIVFGFISAFITRFTQNISAIEPLIVFMFSYLSYLAAETLYLSGILAITACAVTMKKYVEENVSQTSYTT    281 - 350
IKYFMKMLSSVSETLIFIFMGVSTVGKNHEWNWAFICFTLAFCQIWRAISVFALFYISNQFRTFPFSIKD    351 - 420
QCIIFYSGVRGAGSFSLAFLLPLSLFPRKKMFVTATLVVIYFTVFIQGITVGPLVRYLDVKKTNKKESIN    421 - 490
EELHIRLMDHLKAGIEDVCGHWSHYQVRDKFKKFDHRYLRKILIRKNLPKSSIVSLYKKLEMKQAIEMVE    491 - 560
TGILSSTAFSIPHQAQRIQGIKRLSPEDVESIRDILTSNMYQVRQRTLSYNKYNLKPQTSEKQAKEILIR    561 - 630
RQNTLRESMRKGHSLPWGKPAGTKNIRYLSYPYGNPQSAGRDTRAAGFSDDDSSDPGSPSITFSACSRIG    631 - 700
SLQKQEAQEIIPMKSLHRGRKAFSFGYQRNTSQEEYLGGVRRVALRPKPLFHAVDEEGESGGESEGKASL    701 - 770
VEVRSRWTADHGHGRDHHRSHSPLLQKK                                              771 - 798
//

Text Mined References (10)

PMID Year Title
23999434 2013 Common genetic variation at the IL1RL1 locus regulates IL-33/ST2 signaling.
22049213 2012 Functional role of NHE4 as a pH regulator in rat and human colonic crypts.
21738478 2011 Identification of nine novel loci associated with white blood cell subtypes in a Japanese population.
18311140 2008 Newly identified genetic risk variants for celiac disease related to the immune response.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17943310 2008 NHE1, NHE2, and NHE4 contribute to regulation of cell pH in T84 colon cancer cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12576672 2003 Calcineurin homologous protein isoform 2 (CHP2), Na+/H+ exchangers-binding protein, is expressed in intestinal epithelium.
8199403 1994 Chromosomal assignment of four genes encoding Na/H exchanger isoforms in human and rat.