Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 2.7e-04
group 4 medulloblastoma -1.100 6.7e-03
malignant mesothelioma 1.500 1.7e-05
medulloblastoma, large-cell -1.200 3.6e-04
osteosarcoma -1.586 4.7e-04
ovarian cancer -1.100 7.3e-06
psoriasis -1.500 2.8e-04

Gene RIF (2)

AA Sequence

MNALLEQKEQQERLREAAALGDIREVQKLVESGVDVNSQNEVNGWTCLHWACKRNHGQVVSYLLKSGADK      1 - 70
EILTTKGEMPVQLTSRREIRKIMGVEEEDDDDDDDDNLPQLKKESELPFVPNYLANPAFPFIYTPTAEDS     71 - 140
AQMQNGGPSTPPASPPADGSPPLLPPGEPPLLGTFPRDHTSLALVQNGDVSAPSAILRTPESTKPGPVCQ    141 - 210
PPVSQSRSLFSSVPSKPPMSLEPQNGTYAGPAPAFQPFFFTGAFPFNMQELVLKVRIQNPSLRENDFIEI    211 - 280
ELDRQELTYQELLRVCCCELGVNPDQVEKIRKLPNTLLRKDKDVARLQDFQELELVLMISENNFLFRNAA    281 - 350
STLTERPCYNRRASKLTY                                                        351 - 368
//

Text Mined References (11)

PMID Year Title