Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.122 6.2e-03
astrocytic glioma 1.200 1.6e-02
ependymoma 1.500 3.2e-02
intraductal papillary-mucinous adenoma (... 1.400 2.6e-03
intraductal papillary-mucinous carcinoma... 1.400 2.6e-03
intraductal papillary-mucinous neoplasm ... 1.800 5.4e-03
osteosarcoma -1.354 4.5e-03
ovarian cancer -1.600 4.0e-07
Pick disease -1.100 1.1e-03
progressive supranuclear palsy -1.300 2.0e-02
psoriasis -1.100 6.7e-07
sarcoidosis 1.300 4.8e-03
sonic hedgehog group medulloblastoma 1.100 1.2e-02

Gene RIF (1)

AA Sequence

MPSEQKQLFCDEKQTTLKKDYDVKNEIVDRSAPKPKISGSIHYALKNVKIDLPKINIPNEVLLKHEVDKY      1 - 70
RKLFQSKQQTARKSISIKTVSCVEECTLLHKSERAEEEGVKMSAKILNFSCLKCRDNTRYSPNDLQKHFQ     71 - 140
MWHHGELPSYPCEMCNFSANDFQVFKQHRRTHRSTLVKCDICNNESVYTLLNLTKHFTSTHCVNGNFQCE    141 - 210
KCKFSTQDVGTFVQHIHRHNEIHYKCGKCHHVCFTKGELQKHLHIHSGTFPFTCQYCSYGATRREHLVRH    211 - 280
VITLHKEHLYAKEKLEKDKYEKRMAKTSAGLKLILKRYKIGASRKTFWKRKKINSGSDRSIEKNTQVLKK    281 - 350
MNKTQTKSEDQSHVVQEHLSEEKDERLHCENNDKAPESESEKPTPLSTGQGNRAEEGPNASSGFMKTAVL    351 - 420
GPTLKNVMMKNNKLAVSPNYNATFMGFKMMDGKQHIVLKLVPIKQNVCSPGSQSGAAKDGTANLQPQTLD    421 - 490
TNGFLTGVTTELNDTVYMKAATPFSCSSSILSGKASSEKEMTLISQRNNMLQTMDYEKSVSSLSATSELV    491 - 560
TASVNLTTKFETRDNVDFWGNHLTQSHPEVLGTTIKSPDKVNCVAKPNAYNSGDMHNYCINYGNCELPVE    561 - 630
SSNQGSLPFHNYSKVNNSNKRRRFSGTAVYENPQRESSSSKTVVQQPISESFLSLVRQESSKPDSLLASI    631 - 700
SLLNDKDGTLKAKSEIEEQYVLEKGQNIDGQNLYSNENQNLECATEKSKWEDFSNVDSPMMPRITSVFSL    701 - 770
QSQQASEFLPPEVNQLLQDVLKIKPDVKQDSSNTPNKGLPLHCDQSFQKHEREGKIVESSKDFKVQGIFP    771 - 840
VPPGSVGINVPTNDLNLKFGKEKQVSSIPQDVRDSEKMPRISGFGTLLKTQSDAIITQQLVKDKLRATTQ    841 - 910
NLGSFYMQSPLLNSEQKKTIIVQTSKGFLIPLNITNKPGLPVIPGNALPLVNSQGIPASLFVNKKPGMVL    911 - 980
TLNNGKLEGVSAVKTEGAPARGTVTKEPCKTPILKVEPNNNCLTPGLCSSIGSCLSMKSSSENTLPLKGP    981 - 1050
YILKPTSSVKAVLIPNMLSEQQSTKLNISDSVKQQNEIFPKPPLYTFLPDGKQAVFLKCVMPNKTELLKP   1051 - 1120
KLVQNSTYQNIQPKKPEGTPQRILLKIFNPVLNVTAANNLSVSNSASSLQKDNVPSNQIIGGEQKEPESR   1121 - 1190
DALPFLLDDLMPANEIVITSTATCPESSEEPICVSDCSESRVLRCKTNCRIERNFNRKKTSKKIFSKTKT   1191 - 1260
HGSKDSETAFVSRNRNCKRKCRDSYQEPPRRKATLHRKCKEKAKPEDVRETFGFSRPRLSKDSIRTLRLF   1261 - 1330
PFSSKQLVKCPRRNQPVVVLNHPDADAPEVVSVMKTIAKFNGHVLKVSLSKRTINALLKPVCYNPPKTTY   1331 - 1400
DDFSKRHKTFKPVSSVKERFVLKLTLKKTSKNNYQIVKTTSENILKAKFNCWFCGRVFDNQDTWAGHGQR   1401 - 1470
HLMEATRDWNMLE                                                            1471 - 1483
//

Text Mined References (13)

PMID Year Title