Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.23
PubTator Score 6.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Male infertility 206 4.055 2.0
Infertility 188 3.232 1.6

Gene RIF (2)

AA Sequence

MVQIIKDTNEFKTFLTAAGHKLAVVQFSSKRCGPCKRMFPVFHAMSVKYQNVFFANVDVNNSPELAETCH      1 - 70
IKTIPTFQMFKKSQKVTLFSRIKRIICCYRSGFMSNLIFEFCGADAKKLEAKTQELM                  71 - 127
//

Text Mined References (6)

PMID Year Title