Property Summary

NCBI Gene PubMed Count 5
Grant Count 2
Funding $201,594.5
PubMed Score 5.14
PubTator Score 6.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Male infertility 170 4.061 2.0
Infertility 163 3.247 1.6

Synonym

Accession Q6A555 A1L4I2 A6NDK7 Q5T934
Symbols TRX6
SPTRX-3
bA427L11.2

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (2)

PMID Text
23734172 Data indicate that the elevated semen content of SPTRX3/TXNDC8 from assisted reproductive therapy (ART) couples coincided with reduced incidence of pregnancy by in vitro fertilization (IVF) or intracytoplasmic sperm injection (ICSI).
15181017 SPTRX3 is a novel Golgi apparatus-associated thioredoxin, and has a role in aberrant spermatogenesis

AA Sequence

MVQIIKDTNEFKTFLTAAGHKLAVVQFSSKRCGPCKRMFPVFHAMSVKYQNVFFANVDVNNSPELAETCH      1 - 70
IKTIPTFQMFKKSQKVTLFSRIKRIICCYRSGFMSNLIFEFCGADAKKLEAKTQELM                  71 - 127
//

Text Mined References (6)

PMID Year Title
23734172 2013 Semen levels of spermatid-specific thioredoxin-3 correlate with pregnancy rates in ART couples.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15181017 2004 Spermatocyte/spermatid-specific thioredoxin-3, a novel Golgi apparatus-associated thioredoxin, is a specific marker of aberrant spermatogenesis.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.