Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.14
PubTator Score 6.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Male infertility 170 4.061 2.0
Infertility 163 3.247 1.6

Synonym

Accession Q6A555 A1L4I2 A6NDK7 Q5T934
Symbols TRX6
SPTRX-3
bA427L11.2

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
23734172 Data indicate that the elevated semen content of SPTRX3/TXNDC8 from assisted reproductive therapy (ART) couples coincided with reduced incidence of pregnancy by in vitro fertilization (IVF) or intracytoplasmic sperm injection (ICSI).
15181017 SPTRX3 is a novel Golgi apparatus-associated thioredoxin, and has a role in aberrant spermatogenesis

AA Sequence

MVQIIKDTNEFKTFLTAAGHKLAVVQFSSKRCGPCKRMFPVFHAMSVKYQNVFFANVDVNNSPELAETCH      1 - 70
IKTIPTFQMFKKSQKVTLFSRIKRIICCYRSGFMSNLIFEFCGADAKKLEAKTQELM                  71 - 127
//

Text Mined References (6)

PMID Year Title
23734172 2013 Semen levels of spermatid-specific thioredoxin-3 correlate with pregnancy rates in ART couples.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15181017 2004 Spermatocyte/spermatid-specific thioredoxin-3, a novel Golgi apparatus-associated thioredoxin, is a specific marker of aberrant spermatogenesis.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.