Property Summary

NCBI Gene PubMed Count 0
PubMed Score 204.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.79 1.9
Glaucoma 239 3.314 1.7

AA Sequence

MVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVV      1 - 70
LARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGEL     71 - 140
LKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMYIQITDFGTAKVLSPESKQA    141 - 210
RANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFP    211 - 280
KARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNVS    281 - 350
WPGWRARQVALGPPCTGLHARAPDPRVICSRKGRVSVPLRQACWWL                            351 - 396
//