Property Summary

NCBI Gene PubMed Count 5
PubMed Score 10.58
PubTator Score 36.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Visceral leishmaniasis 13 5.233 2.6
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Gene RIF (1)

PMID Text
17301834 KRT39 and KRT40 expression patterns complete sequential expression of the 16 hair keratins in the human hair follicle

AA Sequence

MDTKGCTTTNSPSTPCQNCSRITNVSTISSNNGCHPGGLTVNNCQPAGHVLRIPWDQGCQPTPRFCRKPI      1 - 70
YLMNNFNARFSLDDCSWYGEGINSNEKETMQILNERLANYLQKVRMLERENAELESKIQEESNKELPVLC     71 - 140
PDYLSYYTTIEELQQKILCTKAENSRLVSQIDNTKLTADDLRAKYEAEVSLRQLVESDANGLKQILNVLT    141 - 210
LGKADLEAQVQSLKEELLCLKNNHKEEINSLQCQLGERLDIEVTAAPSADLNQVLQEMRCQYEPIMETNR    211 - 280
KDVEQWFNTQIEELNQQVVTSSQQQQCCQKEIIELRRSVNTLEVELQAQHRMRDSQECILTETEARYTAL    281 - 350
LTQIQSLIDNLEAQLAEIRCALERQNQEYEILLDVKSRLECEITTYRSLLESSDGKRPCYPRATKCEPSP    351 - 420
WTSCKSGAIESTAPACTSSSPCSLKEHCSACGPLSRILVKICTITKEIKDGKVISSYEHVQPCFIIRPAK    421 - 490
V//

Text Mined References (7)

PMID Year Title
17301834 2007 Novel type I hair keratins K39 and K40 are the last to be expressed in differentiation of the hair: completion of the human hair keratin catalog.
16831889 2006 New consensus nomenclature for mammalian keratins.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15617563 2004 The human type I keratin gene family: characterization of new hair follicle specific members and evaluation of the chromosome 17q21.2 gene domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15085952 2004 Comprehensive analysis of keratin gene clusters in humans and rodents.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.