Property Summary

NCBI Gene PubMed Count 5
PubMed Score 10.91
PubTator Score 36.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.4e-06
Disease Target Count Z-score Confidence
Visceral leishmaniasis 14 5.389 2.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.4e-06

Synonym

Accession Q6A163 B2RXK6 Q6IFU6
Symbols K39
KA35
CK-39

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (1)

AA Sequence

MDTKGCTTTNSPSTPCQNCSRITNVSTISSNNGCHPGGLTVNNCQPAGHVLRIPWDQGCQPTPRFCRKPI      1 - 70
YLMNNFNARFSLDDCSWYGEGINSNEKETMQILNERLANYLQKVRMLERENAELESKIQEESNKELPVLC     71 - 140
PDYLSYYTTIEELQQKILCTKAENSRLVSQIDNTKLTADDLRAKYEAEVSLRQLVESDANGLKQILNVLT    141 - 210
LGKADLEAQVQSLKEELLCLKNNHKEEINSLQCQLGERLDIEVTAAPSADLNQVLQEMRCQYEPIMETNR    211 - 280
KDVEQWFNTQIEELNQQVVTSSQQQQCCQKEIIELRRSVNTLEVELQAQHRMRDSQECILTETEARYTAL    281 - 350
LTQIQSLIDNLEAQLAEIRCALERQNQEYEILLDVKSRLECEITTYRSLLESSDGKRPCYPRATKCEPSP    351 - 420
WTSCKSGAIESTAPACTSSSPCSLKEHCSACGPLSRILVKICTITKEIKDGKVISSYEHVQPCFIIRPAK    421 - 490
V//

Text Mined References (7)

PMID Year Title