Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.64
PubTator Score 64.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung carcinoma 1.400 0.000
spina bifida -1.328 0.008
head and neck cancer and chronic obstruc... -1.100 0.012
psoriasis -1.200 0.000

Gene RIF (1)

PMID Text
17301834 KRT39 and KRT40 expression patterns complete sequential expression of the 16 hair keratins in the human hair follicle

AA Sequence

MTSDCSSTHCSPESCGTASGCAPASSCSVETACLPGTCATSRCQTPSFLSRSRGLTGCLLPCYFTGSCNS      1 - 70
PCLVGNCAWCEDGVFTSNEKETMQFLNDRLASYLEKVRSLEETNAELESRIQEQCEQDIPMVCPDYQRYF     71 - 140
NTIEDLQQKILCTKAENSRLAVQLDNCKLATDDFKSKYESELSLRQLLEADISSLHGILEELTLCKSDLE    141 - 210
AHVESLKEDLLCLKKNHEEEVNLLREQLGDRLSVELDTAPTLDLNRVLDEMRCQCETVLANNRREAEEWL    211 - 280
AVQTEELNQQQLSSAEQLQGCQMEILELKRTASALEIELQAQQSLTESLECTVAETEAQYSSQLAQIQCL    281 - 350
IDNLENQLAEIRCDLERQNQEYQVLLDVKARLEGEINTYWGLLDSEDSRLSCSPCSTTCTSSNTCEPCSA    351 - 420
YVICTVENCCL                                                               421 - 431
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17301834 2007 Novel type I hair keratins K39 and K40 are the last to be expressed in differentiation of the hair: completion of the human hair keratin catalog.
16831889 2006 New consensus nomenclature for mammalian keratins.
15617563 2004 The human type I keratin gene family: characterization of new hair follicle specific members and evaluation of the chromosome 17q21.2 gene domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15085952 2004 Comprehensive analysis of keratin gene clusters in humans and rodents.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.