Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.43
PubTator Score 64.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Alpha thalassemia 10 3.417 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
head and neck cancer and chronic obstruc... -1.100 1.2e-02
lung carcinoma 1.400 5.5e-08
psoriasis -1.200 2.0e-06
spina bifida -1.328 8.1e-03

Synonym

Accession Q6A162 Q6IFU5
Symbols K40
KA36
CK-40

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MTSDCSSTHCSPESCGTASGCAPASSCSVETACLPGTCATSRCQTPSFLSRSRGLTGCLLPCYFTGSCNS      1 - 70
PCLVGNCAWCEDGVFTSNEKETMQFLNDRLASYLEKVRSLEETNAELESRIQEQCEQDIPMVCPDYQRYF     71 - 140
NTIEDLQQKILCTKAENSRLAVQLDNCKLATDDFKSKYESELSLRQLLEADISSLHGILEELTLCKSDLE    141 - 210
AHVESLKEDLLCLKKNHEEEVNLLREQLGDRLSVELDTAPTLDLNRVLDEMRCQCETVLANNRREAEEWL    211 - 280
AVQTEELNQQQLSSAEQLQGCQMEILELKRTASALEIELQAQQSLTESLECTVAETEAQYSSQLAQIQCL    281 - 350
IDNLENQLAEIRCDLERQNQEYQVLLDVKARLEGEINTYWGLLDSEDSRLSCSPCSTTCTSSNTCEPCSA    351 - 420
YVICTVENCCL                                                               421 - 431
//

Text Mined References (10)

PMID Year Title