Property Summary

NCBI Gene PubMed Count 2
PubMed Score 7.86

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -3.393 0.001
cystic fibrosis 1.300 0.000
ductal carcinoma in situ -1.700 0.000
ovarian cancer 2.000 0.000

AA Sequence

MTAGSPEECGEVRRSPEGRVSRLGRRLGRRRRPRSPPEPLRVRARLRLRSPSGAFAALGALVVLVGMGIA      1 - 70
VAGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVIMGVGLFVFICANTLLYENR     71 - 140
DLETRRLRQGVLRAQALRPPDGPGWDCALLPSPGPRSPRAVGCAEPEIWDPSPRRGTSPVPSVRSLRSEP    141 - 210
ANPRLGLPALLNSYPLKGPGLPPPWGPRTQTGHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAH    211 - 280
RSWPRLDRLSLGGYAKLGGGGDLGARV                                               281 - 307
//

Text Mined References (4)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15722956 2005 Candidate psychiatric illness genes identified in patients with pericentric inversions of chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.