Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.800 3.3e-03
astrocytoma -1.400 5.8e-15
Astrocytoma, Pilocytic -2.900 4.0e-08
atypical teratoid / rhabdoid tumor -2.800 1.7e-07
colon cancer -3.000 6.0e-08
cutaneous lupus erythematosus -1.300 1.5e-02
ependymoma -2.000 1.5e-03
facioscapulohumeral dystrophy -1.500 3.6e-02
glioblastoma -2.400 1.7e-07
group 3 medulloblastoma -2.800 3.2e-03
medulloblastoma, large-cell -2.100 3.6e-03
oligodendroglioma -1.500 8.9e-14
primary pancreatic ductal adenocarcinoma -1.069 1.7e-02
primitive neuroectodermal tumor -2.500 6.1e-04
psoriasis -1.700 8.1e-05

Gene RIF (1)

AA Sequence

MEPSHKDAETAAAAAAVAAADPRGASSSSGVVVQVREKKGPLRAAIPYMPFPVAVICLFLNTFVPGLGTF      1 - 70
VSAFTVLCGARTDLPDRHVCCVFWLNIAAALIQILTAIVMVGWIMSIFWGMDMVILAISQGYKEQGIPQQ     71 - 140
L//

Text Mined References (10)

PMID Year Title