Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.42
PubTator Score 2.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.500 9.0e-07
osteosarcoma 2.713 1.0e-08
psoriasis 2.000 1.9e-04

Gene RIF (7)

AA Sequence

MAQKPLRLLACGDVEGKFDILFNRVQAIQKKSGNFDLLLCVGNFFGSTQDAEWEEYKTGIKKAPIQTYVL      1 - 70
GANNQETVKYFQDADGCELAENITYLGRKGIFTGSSGLQIVYLSGTESLNEPVPGYSFSPKDVSSLRMML     71 - 140
CTTSQFKGVDILLTSPWPKCVGNFGNSSGEVDTKKCGSALVSSLATGLKPRYHFAALEKTYYERLPYRNH    141 - 210
IILQENAQHATRFIALANVGNPEKKKYLYAFSIVPMKLMDAAELVKQPPDVTENPYRKSGQEASIGKQIL    211 - 280
APVEESACQFFFDLNEKQGRKRSSTGRDSKSSPHPKQPRKPPQPPGPCWFCLASPEVEKHLVVNIGTHCY    281 - 350
LALAKGGLSDDHVLILPIGHYQSVVELSAEVVEEVEKYKATLRRFFKSRGKWCVVFERNYKSHHLQLQVI    351 - 420
PVPISCSTTDDIKDAFITQAQEQQIELLEIPEHSDIKQIAQPGAAYFYVELDTGEKLFHRIKKNFPLQFG    421 - 490
REVLASEAILNVPDKSDWRQCQISKEDEETLARRFRKDFEPYDFTLDD                          491 - 538
//

Text Mined References (15)

PMID Year Title