Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q69YL0
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MVLRRLLAALLHSPQLVERLSESRPIRRAAQLTAFALLQAQLRGQDAARRLQDLAAGPVGSLCRRAERFR      1 - 70
DAFTQELRRGLRGRSGPPPGSQRGPGANI                                              71 - 99
//

Text Mined References (4)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.